FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C80B1_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.506e-19
Identity = 61/192 (31.77%), Postives = 98/192 (51.04%), Query Frame = 2
Query:  131 NYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N  D+ P+L  F L G  K   EV E    ++  +    +++  + K    +S    +D  LD+     +N+  +  ++  +  A  ET+  +IEW + EL  +P+I  K+R+E+ TV+G    + E D   LPYL+A +KETLRL    PLL+P   L    +  Y +P + +I+VNAW +   P  W  P
Sbjct:  214 NPADYFPMLGKFDLFGQRK---EVAECLKGIYAIWGAMLQERKLAKKVDGYKSKNDFVDVCLDSG----LNDYQINALLMELFGAGTETSASTIEWAMTELTKNPKITAKIRSEIQTVVGE-RSVKESDFPNLPYLEATVKETLRLHPPTPLLLPRRALETCTILNYTIPKDCQIMVNAWGIGRDPKTWTDP 397          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BT_ARATH (Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.506e-19
Identity = 51/163 (31.29%), Postives = 92/163 (56.44%), Query Frame = 2
Query:  227 DYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE---INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            DY ++  +K+A     S++ +   I+ I   +  G+   +  D++  ++ +I +A + T+  ++ W I ELV + ++ KK++ E+ T LG   + ITE D   L Y + V+KE  RL  A+P L+P   L   K+ GYD+PA+++I++N + +A  P  W  P
Sbjct:  250 DYHLKPGRKVAD----SSDIIDVVINMIKKQEKDGDSFKLTTDHLKGMISDIFLAGVSTSASTLIWAITELVRNRKVMKKVQEEIRTTLGDKKERITEQDLTNLHYFKLVVKEIFRLHPAVPFLLPRETLSHVKIQGYDIPAKTQIMINVYAIARDPKLWTNP 408          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BB_ARATH (Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.506e-19
Identity = 53/151 (35.10%), Postives = 81/151 (53.64%), Query Frame = 2
Query:  272 MSNESLKCAIDHILDAQTKGEIN-------EDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + +ES+K  I  +L    +GEI         DN   I+ NI  A I+T+   + W +  L+++P + KK + E+  V+     I E D  +L YL+ V+KET R+   +PLL+P     D K+GGYD+P ++ I VN W +   P  WK P
Sbjct:  254 LEDESIKDDIIDLLLKMERGEIELGEFQLTRDNTKGILFNILNAGIDTSAQVMTWVMTYLISNPRVMKKAQAEVREVIKNKDDIIEEDIERLEYLKMVVKETFRVLPLVPLLIPREASKDVKIGGYDIPKKTWIHVNIWAIHRNPNVWKDP 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71B8_ARATH (Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.506e-19
Identity = 64/234 (27.35%), Postives = 112/234 (47.86%), Query Frame = 2
Query:   20 MYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKER---RLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKG--EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ++R+ F + F   D    +RL+ L  E       F + + DF P    +L   +       E+   +L  F  + ++E  K+  ++  SN  +   +D I  +   G  +I  D+++ ++ +I +  +     ++ W + EL  HP + KKLR E+   LGP  + ITE D  K+ YL+ VIKET RL    P L+P   + D ++ GY +P  + I ++ + +   P  W  P
Sbjct:  181 IFRVSFGQNFRECDFIDMDRLEELVQESE--TNVFSFAFTDFFPTGLGWLVDRISGQHSRIEKAFSKLTKFFQHVIDEELKIGQSQDHSN-LVSSMLDMINRSTEYGSFKITSDHLIAMMTDIVLGGVNAGTITMIWTMTELTRHPRVMKKLREEIRATLGPNKERITEEDLEKVEYLKLVIKETFRLHPPGPFLLPRQVMSDIEIQGYHIPKNAHIKISTYAIGRDPKCWTNP 411          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AC_ARATH (Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.506e-19
Identity = 55/197 (27.92%), Postives = 105/197 (53.30%), Query Frame = 2
Query:  125 EYNYGDFIPILRPF--LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEIN----EDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGP-GHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            E+  GD++P L     + G+    KEV +    L  D  V+E  +  + K       +  +D +L  +++  I      D++ +++ ++ +    T+   +EW + EL+ +P + KKL++E+ + + P G  I E D   + YL+AVIKE  R+   +PL++P +   D K+ GY++ A +++++NAW +   PA W
Sbjct:  215 EFPIGDYVPALAWIDRINGFNARIKEVSQGFSDLM-DKVVQEHLEAGNHK-------EDFVDILLSIESEKSIGFQAQRDDIKFMILDMFIGGTSTSSTLLEWIMTELIRNPNVMKKLQDEIRSTIRPHGSYIKEKDVENMKYLKAVIKEVFRVHPPLPLILPRLLSEDVKVKGYNIAAGTEVIINAWAIQRDPAIW 403          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP21A_CANLU (Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.497e-19
Identity = 61/224 (27.23%), Postives = 107/224 (47.77%), Query Frame = 2
Query:   47 FESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAST--KSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGP---GHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F  ++D L +       +  R  + +     D IP LR F    L   K   E R  + +    + ++ + +   + M++  L+  +  +   +  G++ E +V   V ++ +   ETT  ++ W +A L++HPEIQ++L+ ELD  LGP   G +I   D  +LP L A + E LRLR  +PL +PH     + + GYD+P    ++ N          W++P
Sbjct:  177 FGDKEDTLVHTFHDCVQDLMRTWEHWSIQMLDIIPFLRFFPNPGLWRLKRALENRDHIVEKQLRQHKESMVAGQWRDMTDYMLQ-RVGRLRAEEGCGQLLEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQQRLQEELDRELGPGASGSRIPYRDPTRLPLLSATVAEVLRLRPVVPLALPHCTTRPSSISGYDIPEGMVVIPNLQGAHLDETVWERP 399          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP21A_CANFA (Steroid 21-hydroxylase OS=Canis familiaris GN=CYP21 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.497e-19
Identity = 61/224 (27.23%), Postives = 107/224 (47.77%), Query Frame = 2
Query:   47 FESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAST--KSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGP---GHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F  ++D L +       +  R  + +     D IP LR F    L   K   E R  + +    + ++ + +   + M++  L+  +  +   +  G++ E +V   V ++ +   ETT  ++ W +A L++HPEIQ++L+ ELD  LGP   G +I   D  +LP L A + E LRLR  +PL +PH     + + GYD+P    ++ N          W++P
Sbjct:  177 FGDKEDTLVHTFHDCVQDLMRTWEHWSIQMLDIIPFLRFFPNPGLWRLKRALENRDHIVEKQLRQHKESMVAGQWRDMTDYMLQ-RVGRLRAEEGCGQLLEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQQRLQEELDRELGPGASGSRIPYRDPTRLPLLSATVAEVLRLRPVVPLALPHCTTRPSSISGYDIPEGMVVIPNLQGAHLDETVWERP 399          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C84A1_ARATH (Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.497e-19
Identity = 70/248 (28.23%), Postives = 113/248 (45.56%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPIL---------------RPFLRGYLK--ICKEVKERRLQ-LFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N  YR  F    E   D     L+    E S+L  +F  N  DFIP                 R  L G++   I + +K++  Q    D  V +   +    +  +E  K  +    D Q   ++  DN+  I+ ++     ET   +IEW + EL+  PE  K+++ EL  V+G   ++ E D  KL YL+  +KETLR+   IPLL+ H    D  + G+ +P +S++++NA+ +   P  W  P
Sbjct:  186 NITYRAAFGSACEKGQDEFIRILQ----EFSKLFGAF--NVADFIPYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHMKKKENQNAVDDGDVVDTDMVDDLLAFYSEEAKL-VSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGLDRRVEESDIEKLTYLKCTLKETLRMHPPIPLLL-HETAEDTSIDGFFIPKKSRVMINAFAIGRDPTSWTDP 425          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71E1_SORBI (4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.497e-19
Identity = 46/121 (38.02%), Postives = 72/121 (59.50%), Query Frame = 2
Query:  344 DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGH-QITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D+V  IV +  + AI+T+  +I W ++EL+  P++ +K + E+   +G    ++   D  K+PYL+ V+KETLRL     LLVP   + D  + GYDVPA +++ VNAW +   PA W  P
Sbjct:  316 DHVKAIVLDTFIGAIDTSSVTILWAMSELMRKPQVLRKAQAEVRAAVGDDKPRVNSEDAAKIPYLKMVVKETLRLHPPATLLVPRETMRDTTICGYDVPANTRVFVNAWAIGRDPASWPAP 436          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP21A_FELCA (Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.110e-18
Identity = 65/199 (32.66%), Postives = 98/199 (49.25%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTK-SMSNESLKCAIDHILDAQTK-------GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGP---GHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D +P LR F    L+  K+  E R     D  VE  K+L   K SM     +   D++L    K       G + E +V   V ++ +   ETT  ++ W +A L++HPEIQ++L+ ELD  LGP   G ++   D  +LP L A I E LRLR  +PL +PH     + + GYD+P  + ++ N          W++P
Sbjct:  208 DIVPFLRFFPNPGLRRLKQALENR-----DRIVE--KQLRQHKDSMVAGQWRDMTDYMLQGMGKPKVEKGHGRLLEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQQRLQEELDCELGPGASGSRVPLKDPSRLPLLTATIAEVLRLRPVVPLALPHRTTRHSSILGYDIPEGTVVIPNLQGAHLDDTVWEQP 399          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
C80B1_ESCCA6.506e-1931.77(S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (F... [more]
C71BT_ARATH6.506e-1931.29Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=C... [more]
C71BB_ARATH6.506e-1935.10Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=C... [more]
C71B8_ARATH6.506e-1927.35Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CY... [more]
C71AC_ARATH6.506e-1927.92Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=C... [more]
CP21A_CANLU8.497e-1927.23Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=... [more]
CP21A_CANFA8.497e-1927.23Steroid 21-hydroxylase OS=Canis familiaris GN=CYP2... [more]
C84A1_ARATH8.497e-1928.23Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CY... [more]
C71E1_SORBI8.497e-1938.024-hydroxyphenylacetaldehyde oxime monooxygenase OS... [more]
CP21A_FELCA1.110e-1832.66Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top