FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A2_BALAC (Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3)

HSP 1 Score: 93.5893 bits (231), Expect = 1.110e-18
Identity = 56/190 (29.47%), Postives = 88/190 (46.32%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQ--TKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            DF PIL+      L+  K    R LQ       E  +     K+   + +     H  D    + G + +   + +V +I  A  +    +I W +  LV +PEIQ+K++ ELDTV+G   +    D  +LPYL+A I ET R    +P  +PH  + D  L G+ +P E  + +N W + + P  W  P
Sbjct:  237 DFFPILKYLPNPALQKYKSFNRRFLQFLWKMVQEHHQDF--DKNRVQDIVGALFKHYEDNSRASGGLMPQKKTVNLVNDIFAAGFDPITTAISWSLLYLVTNPEIQRKIQQELDTVIGRARRPRLSDRSQLPYLEAFILETFRHSSFVPFTIPHSTIRDTTLNGFYIPKELCVFINQWQVNHDPKLWGDP 424          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AO_ARATH (Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3)

HSP 1 Score: 93.5893 bits (231), Expect = 1.110e-18
Identity = 45/121 (37.19%), Postives = 72/121 (59.50%), Query Frame = 2
Query:  332 EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            EI+  ++  I+ ++ V  ++TT   +EW + EL+ H E   +L+ E+  V      ++E D   + YL+AVIKETLRL   +PL+VPH + HD KL  Y +PA + +++NAW +    A W
Sbjct:  277 EIDRLSIKAIILDVFVGDMDTTYTLLEWAMTELLCHHECLDRLQEEVRMVCKDKSGVSEDDLQDMKYLKAVIKETLRLHPPLPLMVPHESTHDVKLRDYHIPAGTHVMINAWAIGREAATW 397          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2U1_MOUSE (Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 42/129 (32.56%), Postives = 73/129 (56.59%), Query Frame = 2
Query:  317 AQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            A  +   +ED + YI+ ++ +A  +TT  S+ W +  +  +P++QKK+  E++ V+G     +  D  ++PY +A I E  RL M +PL +PHM      L G+ +P  + +L+N W +   PA W+KP
Sbjct:  317 ASRRSSFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQKKVHEEIERVIGCDRAPSLTDKAQMPYTEATIMEVQRLSMVVPLAIPHMTSEKTVLQGFTIPKGTVVLINLWSVHRDPAIWEKP 445          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP21A_PIG (Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 64/229 (27.95%), Postives = 111/229 (48.47%), Query Frame = 2
Query:   47 FESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDA-------QTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPG---HQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F  ++D L + L     +  +  + +     D +P LR F    L+  K+  E R     D+ VE++ +    +SM     +  +D++L         + +G++ E +V   V ++ +   ETT  ++ W +  L++HPEIQ +L+ ELD  LGPG    ++   D  +LP L A I E LRLR  +PL +PH     + + GYD+P  + ++ N          W++P
Sbjct:  178 FGDKEDTLVHALHDCVQDLMKTWEHWSIQILDMVPFLRFFPSPGLRRLKQAIENR-----DHLVEKQLR-RHKESMVAGQWRDMLDYMLQEAGRQRVEEGQGQLLEGHVHMSVVDLFIGGTETTANTLSWAVVYLLHHPEIQWRLQEELDRELGPGAAGSRVPYKDRARLPLLNATIAEVLRLRPVVPLALPHRATRPSSIFGYDIPEGTVVIPNLQGAHLDETVWEQP 400          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP21A_LYNLY (Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 65/199 (32.66%), Postives = 98/199 (49.25%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTK-SMSNESLKCAIDHILDAQTK-------GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGP---GHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D +P LR F    L+  K+  E R     D  VE  K+L   K SM     +   D++L    K       G + E +V   V ++ +   ETT  ++ W +A L++HPEIQ++L+ ELD  LGP   G ++   D  +LP L A I E LRLR  +PL +PH     + + GYD+P  + ++ N          W++P
Sbjct:  208 DIVPFLRFFPNPGLQRLKQALENR-----DRIVE--KQLRQHKDSMVAGQWRDMTDYMLQGMGKPRAEKGHGRLLEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQQRLQEELDCELGPGASGSRVPLKDPSRLPLLTATIAEVLRLRPVVPLALPHRTTRHSSILGYDIPEGTVVIPNLQGAHLDDTVWEQP 399          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP21A_HUMAN (Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 57/193 (29.53%), Postives = 98/193 (50.78%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAST--KSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPG---HQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D IP LR F    L+  K+  E+R  + +    + ++ L +   + M +  L+      ++ +  G++ E +V     ++ +   ETT  ++ W +  L++HPEIQ++L+ ELD  LGPG    ++   D  +LP L A I E LRLR  +PL +PH     + + GYD+P  + I+ N          W++P
Sbjct:  210 DVIPFLRFFPNPGLRRLKQAIEKRDHIVEMQLRQHKESLVAGQWRDMMDYMLQGVAQPSME-EGSGQLLEGHVHMAAVDLLIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDETVWERP 401          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A2_MACFA (Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 66/234 (28.21%), Postives = 102/234 (43.59%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAST-----KSMSNESLKCAIDHILDAQTKGE------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F + F    D + + +K        +  +   N  DF PILR     YL          LQ FK +    R+ L  T     +     S++     +     KG       I ++ ++ +V +I  A  +T   +I W +  LV  PEIQ+K++ ELD V+G G +    D  +LPYL+A I ET R    +P  +PH    D  L G+ +P E  + +N W + + P  W  P
Sbjct:  205 FGQHFPESSDEMLSLVK---NSHEFVESASSGNPVDFFPILR-----YLP------NPALQRFKAFNQRFRRFLQKTVQEHYQDFDKNSVQDITGALFKHSKKGPRASGNLIPQEKIVNLVNDIFGAGFDTIATAISWSLMYLVTKPEIQRKIQKELDAVIGRGRRPRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTTLNGFYIPRECCVFINQWQVNHDPQLWGDP 424          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_SPAAU (Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 65/227 (28.63%), Postives = 106/227 (46.70%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHI----LDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F RR++  +  L N L  L+ E  ++  S   N  DFIPIL+      +K    + +R    F    V E       K    +     IDH     LD  +  +++++ V+ IV ++  A  +T   ++ W +  LV +PEIQ++L  E+   +G        D  KLP+L+A I E  R    +P  +PH +  D  L GY +P ++ + +N W + + P  WK P
Sbjct:  208 FGRRYDHNNQELLN-LVNLSDEFGQVVASG--NPADFIPILQYLPSTSMKKFVSINDR-FNAFVQKIVSEHYTTFD-KDNIRDITDSLIDHCEDRKLDENSNVQMSDEKVVGIVNDLFGAGFDTISTALSWSVMYLVAYPEIQERLYQEMKESVGLDRTPCLSDKPKLPFLEAFILEIFRHSSFLPFTIPHCSSKDTSLNGYFIPKDTCVFINQWQINHDPELWKDP 429          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP17A_SQUAC (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 57/231 (24.68%), Postives = 111/231 (48.05%), Query Frame = 2
Query:   29 IMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + F+  +E +D       K   G  + +A+    +  D  P L+ F    L   K+    R  + +  F + +   +S  +  N+     +   ++A+          + +D+++  V +I  A +ET+  +  W I  L++HPE+QKK++ E+D+ +G        D   + +L A I E LR++   PLL+PH+ L D+ +G Y +P  +++++N W + +    WK P
Sbjct:  187 LCFNSTYEKEDPEFQTMRKYSQGIVNTVAKD---SLIDIFPWLQFFPNENLHTLKQCIATRDSILQKKFEDHKANYSSDSA--NDLFNILLKAKMNAENNNSSVHEAGLTDDHMVMTVADIFGAGVETSSTAFAWMIIYLIHHPEVQKKIQEEIDSNIGFERTPKMSDKGNMNFLNATIHEILRIQPVSPLLIPHVALADSSIGDYTIPKGTRVIINLWAIHHDEKEWKNP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 57/193 (29.53%), Postives = 100/193 (51.81%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCA-IDHILDAQTKGEINEDNVLYIV----ENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D++PIL PF     K   +V++++++     F+E+RKK+  +  +   +   + +D + D + +G  +      +V    E +N    +TT  +IEW I  L+ +P IQ +L  E+   +G  ++I E D  K+PYL AV+KE LR      + + H     AKLGGYD+P    + +    +++ P  W +P
Sbjct:  232 DYLPILSPFFSKQRKHAMDVRKQQIKTIVP-FIEQRKKILESPEIDKTAASFSYLDTLFDLKIEGRNSTPTYPELVTLCSEFLN-GGTDTTATAIEWAIGRLIENPNIQSQLYEEIKKTVGE-NKIDEKDIEKMPYLNAVVKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTGVNVEIFLPGISDDPNLWSEP 421          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP1A2_BALAC1.110e-1829.47Cytochrome P450 1A2 OS=Balaenoptera acutorostrata ... [more]
C71AO_ARATH1.110e-1837.19Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=C... [more]
CP2U1_MOUSE1.449e-1832.56Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2... [more]
CP21A_PIG1.449e-1827.95Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1... [more]
CP21A_LYNLY1.449e-1832.66Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 ... [more]
CP21A_HUMAN1.449e-1829.53Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 ... [more]
CP1A2_MACFA1.449e-1828.21Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1... [more]
CP1A1_SPAAU1.449e-1828.63Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=... [more]
CP17A_SQUAC1.449e-1824.68Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalu... [more]
C77A2_SOLME1.449e-1829.53Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top