FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DH_MACFA (Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.733e-17
Identity = 66/234 (28.21%), Postives = 111/234 (47.44%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILR--PFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + + RRFE  DDP F RL  L  E  +    F     + IP+L   P L G  K+ +  K    QL  D  + E +          +  +  +  +  A+   E   NE+N+  +V ++  A + TT  ++ WG+  ++ HP++Q++++ E+D V+G   +    D  ++PY  AVI E  R    +PL V HM   D +L G+ +P  + +  N   +    A W+KP
Sbjct:  184 NVIASLTYGRRFE-YDDPRFLRLFDLTHEALKEESGFLREVLNAIPLLLRIPGLAG--KVLRSQKAFLTQL--DELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNEENLRMVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQARMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIELQGFLIPKGTTLFTNLSSVLKDEAVWEKP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_OPSTA (Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.733e-17
Identity = 56/227 (24.67%), Postives = 107/227 (47.14%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILR----PFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F RR++  D  L + L  L+ E  ++  +   N  DFIP+LR      ++ +L I     +   ++  +++    K   + + +++  +    D  LD     +++++ ++ IV ++  A  +T    + W +  LV +PEIQ++L  E+   +G        D   LP+L A I E  R    +P  +PH    +  L GY +P ++ + +N W + + P  WK P
Sbjct:  208 FGRRYDHYDQELVS-LVNLSEEFGQVVGTG--NLADFIPVLRFLPSTAMKKFLSINDRFDKFVKKIVSEHYATYNKD--NIRDITDSLIDHCEDRKLDENCNVQVSDEKIVGIVNDLFGAGFDTVSTGLSWSVMYLVAYPEIQERLYQEIKDSVGTERMPLLSDRPSLPFLDAFILEIFRHSSFLPFTIPHCTTKNTSLNGYFIPKDTCVFINQWQINHDPELWKDP 429          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C78A1_MAIZE (Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.733e-17
Identity = 63/213 (29.58%), Postives = 105/213 (49.30%), Query Frame = 2
Query:  101 RSRLAQSFE----YNYGDFIPILRPFLRGYLKICKEVKER------RLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLV-PHMNLHDAKL-GGYDVPAESKILVNAWWLANXPAPWKKP 703
            +S + + FE    +N+ D +P L      +L     V  R      R+Q F    ++E ++     +  N++    +D +L  +   ++ +D+++ I+  +     +TT    EW +AELV HP +Q ++R E+D  +G G   T+ D  ++PYLQAV+KETLR     PLL    +   D  L  G  VPA +  +VN W + +  A W  P
Sbjct:  248 KSMVREGFELLGAFNWSDHLPWL-----AHLYDPSNVTRRCAALVPRVQTFVRGVIDEHRRRRQNSAALNDNADF-VDVLLSLEGDEKLGDDDMVAILWEMVFRGTDTTALLTEWCMAELVRHPAVQARVRAEVDAAVGAGGCPTDADVARMPYLQAVVKETLRAHPPGPLLSWARLATADVPLCNGMVVPAGTTAMVNMWAITHDAAVWADP 454          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BU_ARATH (Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.733e-17
Identity = 48/163 (29.45%), Postives = 86/163 (52.76%), Query Frame = 2
Query:  230 YFVEERKKLASTKSMSNES-LKCAIDHILDAQTKG---EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +F +   +L  TK + + S L  A+  +++   K    +I  D+++ ++ ++ +A +     ++ W + EL  HP + KKL+ E+   LGP  + ITE D  K+ YL  VIKE+ RL    PLL+P   + D ++ GY +P  + + +N + +   P  W  P
Sbjct:  247 FFEDVIDELLKTKQLDDHSDLVTAMLDVINRPRKFGSLKITYDHLIAMMSDVVLAGVNAGTVTMIWTMTELTRHPRVMKKLQEEIRATLGPNKERITEEDLEKVEYLNLVIKESFRLHPPAPLLLPRETMSDIEIQGYHIPKNAHVKINTYAIGRDPKRWTNP 409          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BC_ARATH (Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.733e-17
Identity = 50/151 (33.11%), Postives = 80/151 (52.98%), Query Frame = 2
Query:  272 MSNESLKCAIDHILDAQTKGE-------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + +E +K  I  +L    +GE       +  D+   I+ NI  A I+T+   + W +  L+++P + KK + E+  V+     I E D  +L YL+ VIKET R+   +PLL+P     D K+GGY++P ++ I VN W +   P  WK P
Sbjct:  254 LEDEIIKDDIIDLLLKMERGETTLGEFQLTRDHTKGILANILNAGIDTSAQVMTWVMTYLISNPRVLKKAQAEVREVIKHKDDIIEEDIERLQYLKMVIKETFRINPLVPLLIPREASKDVKIGGYNIPKKTWIHVNIWAIHRNPNVWKDP 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AP_ARATH (Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.570e-17
Identity = 61/227 (26.87%), Postives = 110/227 (48.46%), Query Frame = 2
Query:   26 RIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILR--PFLRGY-LKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKG-EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            R+   R++  + D      K L    S L  +F  + G F+P L    ++RG+  ++ K  K+       D+F +  +            L  A+  +   ++ G EI   ++  I  ++ V   +T+   +EW + EL+ HP+   +L+ E+ T+     +++E D   + YL+AVIKE LRL    P++ PH +  D KL  Y +PA +++++NAW +    A W
Sbjct:  181 RVALGRKYGGETD-----FKKLTDRLSELLGTF--SIGSFVPWLAWVDWIRGWDAQLDKMGKD-----LDDFFEKVVQDHEDGDRRDGTDLIDALLRVKREKSPGFEIERVSIKAITLDVFVGGSDTSFTLLEWAMTELLRHPKSLNRLQEEVRTICKGKSRVSEDDIQGMKYLKAVIKEALRLHPPFPMMAPHESTEDVKLRDYHIPAGTQVMMNAWAIGREVATW 395          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AE_ARATH (Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.662e-17
Identity = 45/126 (35.71%), Postives = 73/126 (57.94%), Query Frame = 2
Query:  332 EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDT-----VLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            +I   ++ +++ ++ +A  ETT   +EW + EL+ HPE  KKL++E+       +L     I+E D   + YL+AV+KE LRL   +PLLVP     D KL GYD+ A +++++NAW +      W
Sbjct:  283 QIRRSDIKFLILDMFLAGTETTYALLEWIMTELIRHPECMKKLQDEIRAKATKLIL----YISEEDVEDMKYLKAVVKEVLRLHPPLPLLVPRELSEDIKLKGYDIAAGTQVIINAWAIQRDTMTW 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BY_ARATH (Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=2 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 6.089e-17
Identity = 39/125 (31.20%), Postives = 72/125 (57.60%), Query Frame = 2
Query:  329 GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            G++  +++  ++ N+ +  I T+  ++ W + EL+ +P + KK+++E+   +G    I   D  +L YL+ VI ET RL    PLLVP   + + ++ GY +PA++++ VN W +   P  WK P
Sbjct:  284 GKLTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGGKSMICLDDIDQLHYLKMVINETWRLHPPAPLLVPREVMSEFEINGYTIPAKTRLYVNVWGIGRDPDTWKDP 408          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BM_ARATH (Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.089e-17
Identity = 48/168 (28.57%), Postives = 88/168 (52.38%), Query Frame = 2
Query:  209 RLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKG--EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            RL  F  + +++  K   ++  S + +   +D I      G  ++  D++  ++ ++ +A +     ++ W + EL  HP + KKL+ E+  +LG   + ITE D  K+ YL+ VI+ET RL    PLL+P   + D K+ GY++P  + I +N + +   P  W+ P
Sbjct:  243 RLSNFFQHVIDDHLKPGQSQDHS-DIIGVMLDMINKESKVGSFQVTYDHLKGVMSDVFLAGVNAGAITMIWAMTELARHPRVMKKLQQEIREILGDNKEKITEQDLEKVHYLKLVIEETFRLHPPAPLLLPRETMSDLKIQGYNIPKNTMIEINTYSIGRDPNCWENP 409          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BD_ARATH (Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.089e-17
Identity = 43/115 (37.39%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  359 IVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            I+ +I +A ++T+  +I W +  L+ +P + KK + E+  V+     ITE D   L YL+ V+KETLR+   +PLL P     D K+GGY++P ++ I VN W +   P  WK P
Sbjct:  290 ILLDILLAGVDTSGHTITWVMTHLIKNPRVMKKAQAEVREVIKNKDNITEEDIEGLEYLKMVVKETLRINPLVPLLTPREASKDVKIGGYNIPKKTWIHVNIWAIHRNPNVWKDP 404          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP2DH_MACFA2.733e-1728.21Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP... [more]
CP1A1_OPSTA2.733e-1724.67Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 ... [more]
C78A1_MAIZE2.733e-1729.58Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 S... [more]
C71BU_ARATH2.733e-1729.45Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=C... [more]
C71BC_ARATH2.733e-1733.11Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=C... [more]
C71AP_ARATH3.570e-1726.87Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=C... [more]
C71AE_ARATH4.662e-1735.71Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=C... [more]
C71BY_ARATH6.089e-1731.20Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=C... [more]
C71BM_ARATH6.089e-1728.57Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=C... [more]
C71BD_ARATH6.089e-1737.39Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top