FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C515B_DICDI (Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515b1 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.722e-15
Identity = 65/248 (26.21%), Postives = 116/248 (46.77%), Query Frame = 2
Query:    5 MMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL---DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNEL--DTVLGPGHQITEPDT----------HKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + +N +Y  +F      +D+ + + +         L         D+I +LRPF   + K+ KE+ +R  +  K   V+++ +L     +  ++ KC ID+++    +     I  D + YIV ++ V   ++T  ++EW I  L NH  IQ+KL NE+  +T        TE D           +  P   A +KETLR    +PL +PH+   D ++GGY +P  ++I+ N +  +N    +  P
Sbjct:  173 LSFNIIYSYLFSETIPYEDELIPSDILDFIHASEELLVVLSRMPSDYIKVLRPF-ESHKKL-KEICDRMSKFIKPR-VDKKVEL-----LDQDNPKCFIDYLILQIRSDPSQTIKIDAIQYIVLDLLVGGTDSTSSALEWMILFLSNHESIQEKLYNEICKNTNTNTTATTTENDNESYFPKLIEKNNYPLFNACVKETLRRSPPVPLGLPHLCSEDTEIGGYLIPKGTQIISNIYSASNCDKVFTDP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2L1_PANAR (Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.658e-14
Identity = 65/244 (26.64%), Postives = 113/244 (46.31%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDP--LFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQL--FKDYFVEERKKLASTKSMSNESLKCAID-HILDAQTKGE-----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            L + N +++++ D R+  QD     F +L     +     Q F  N  +++P L      ++K    V+  R  +   KDY     K+  +T   SN   K  +D +++D Q + E     +N + V  ++ ++  A  ETT   I W I  L+ +PE+Q K++ E+D  +  G   +     KL Y +A I E  R+   +PL V H    D +L GY +P  + ++ +       P+ W+KP
Sbjct:  167 LAVLNVIWKLVADHRYSLQDQEGQYFTQLLTTTTDNM---QGFALNLFNYLPWLLMITPDFVKNWMGVRVLRDGVCELKDYMKTFIKEHQATLDPSNP--KDLLDAYLIDLQERKEDPLSTMNIETVRAVIMDLFGAGTETTSTMIRWTILYLMKYPEVQAKIQREIDAAVPRGTLPSLEHKDKLAYFEATIHEVHRIVSLVPLGVSHYTNQDTELAGYRLPKGTVVMSHLECCHRDPSYWEKP 405          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2R1_HUMAN (Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.166e-14
Identity = 64/238 (26.89%), Postives = 112/238 (47.06%), Query Frame = 2
Query:   29 IMFDRRFESQDDPLFNRLKALNGERSRLAQS---FEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV--EERKKLASTKSMSNESL--KCAIDHILDAQTKGE------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            I+F  RF  +D   F  +  L  E   LA S   F YN   +I IL PF             +  QLF++  V  +   +L    S++ +    +  +D  LD   +G+       +++N+++ V  + +A  ETT   + W I  +  +P IQ +++ E+D ++GP  + +  D  K+PY +AV+ E LR    +PL + H    DA + GY +P  + ++ N + +      W+ P
Sbjct:  194 IIFGERFTYEDTD-FQHMIELFSENVELAASASVFLYNAFPWIGIL-PF------------GKHQQLFRNAAVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDP 417          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DR_MESAU (Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.166e-14
Identity = 34/126 (26.98%), Postives = 69/126 (54.76%), Query Frame = 2
Query:  326 KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +   N++N+  +V ++ +A + TT  ++ W +  ++ HP++Q +++ E+D V+G   +    D  ++PY  AVI E  R     P+ +PHM  HD ++ G+ +P  + ++ N   +      W+KP
Sbjct:  290 ESSFNDENLRMVVADMFIAGMVTTSTTLSWALLLMILHPDVQSRVQQEIDDVIGQVRRPEMADQARMPYTNAVIHEVQRFGDIAPVNIPHMTSHDVEVQGFLIPKGTTLIPNLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C7D95_MENGR (Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.166e-14
Identity = 44/166 (26.51%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  206 RRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            RR+    +  VEE K   S +    + +        D+Q K  I  + +   + +   A  ET+  +  W +AEL+ +P +  K + E+   L     +   D  +L Y+++V+KET+R+   IP L+P     + ++ GY +P +++I++N W +   P  W+KP
Sbjct:  240 RRVDTILEAIVEEHKLKKSGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTFSAGTETSSTTTLWVMAELMRNPAVMAKAQAEVRAALKGKTSVDVDDVQELKYMKSVVKETMRMHPPIP-LIPRSCREECEVNGYKIPNKARIMINVWSMGRNPLYWEKP 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71DD_MENPI (Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.166e-14
Identity = 45/166 (27.11%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  206 RRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            RR+    +  VEE K   S +    + +        D+Q K  I  + +   + +   A  ET+  +  W +AEL+ +PE+  K + E+   L         D  +L Y+++V+KET+R+   IP L+P     + ++ GY +P +++I++N W +   P  W+KP
Sbjct:  243 RRVDAILEAIVEEHKLKKSGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTFSAGTETSSTTTLWVMAELMRNPEVMAKAQAEVRAALKGKTDWDVDDVQELKYMKSVVKETMRMHPPIP-LIPRSCREECEVNGYTIPNKARIMINVWSMGRNPLYWEKP 407          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DP_PIG (Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 2.829e-14
Identity = 56/238 (23.53%), Postives = 106/238 (44.54%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRL----KALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEV--KERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F RRFE  D  +   L    + L  E   + Q  E           P LR    +C ++  +++   +  D  + E K          +     +D + +A+   E   N++N+  +V ++  A + TT  ++ W +  ++ HP++Q++++ E+D V+G   Q    D   +P+  AV+ E  R    +PL V HM   D ++ G+ +P  + ++ N   +      WKKP
Sbjct:  187 NVIASLTFARRFEYNDPRMLKLLDLVLEGLKEEVGLMRQVLE---------AMPVLRHIPGLCAKLFPRQKAFLVMIDELITEHKMTRDLAQPPRDLTDAFLDEMKEAKGNPESSFNDENLRLVVAHLFSAGMITTSTTLAWALLLMILHPDVQRRVQQEIDEVIGHVRQPEIKDQALMPFTLAVLHEVQRFGDIVPLGVAHMTSCDIEVQGFLIPKGTTLITNLTSVLKDETVWKKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C99A2_ORYSJ (Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.829e-14
Identity = 54/192 (28.12%), Postives = 97/192 (50.52%), Query Frame = 2
Query:  134 YGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEIN----EDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVL-GPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            +GD  P LR F+     +   +   R QL   +     K +A  +    +SL   ++ +L  + +G++       N+  I+ ++     ETT  + EW ++EL+ +PE+  K++ E+  V      Q  E     L Y++ VIKET+RL   +PLL+PH+      +GGY+V   +++++N+W +A  P  W
Sbjct:  250 FGDLFPSLR-FIDAMTGLRSRLWRARGQLDSVF----DKIIAQCEEHQGDSL---VNVLLRIRDQGDLEFPFGTTNIKAIILDMFTGGTETTSSAAEWVMSELMRNPEVMAKVQAEVRRVFDNKSPQDHEGLIDNLRYMKMVIKETMRLNPVLPLLMPHLCRETCDIGGYEVVEGTRVVINSWAMARSPEYW 433          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2K4_ONCMY (Cytochrome P450 2K4 OS=Oncorhynchus mykiss GN=cyp2k4 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.694e-14
Identity = 59/238 (24.79%), Postives = 107/238 (44.96%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL----DAQTKGEIN----EDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I++  RFE   DPLF  +     E   L  S      +  P L P++    ++ K V + ++++     +E  + L  T  ++    +  +D  L      +  G+++    +DN+L+ + N+  A  +TT  ++ WG+  +  +P IQ +++ E+  V+G    + E D   LPY  AVI ET RL    P+ VPH    D    GY +   + ++     +      W+ P
Sbjct:  188 NIISAIVYGSRFE-YTDPLFTGMVDRVNENVHLIGSASIQMYNMFPWLGPWINNLTRLKKNVADLKMEV-----IELVRGLKET--LNPHMCRGFVDSFLVRKQTLEESGKMDSFYHDDNLLFSIGNLFGAGTDTTGTTLRWGLLLMAKYPHIQDQVQEEISRVIGSRQTLVE-DRKNLPYTDAVIHETQRLANISPMAVPHTTSRDVTFQGYFIKKGTSVIPLLMSVLQDDNEWESP 416          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2E1_BOVIN (Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.694e-14
Identity = 65/226 (28.76%), Postives = 103/226 (45.58%), Query Frame = 2
Query:   11 YNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQS----FEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINV-------AAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            YN +  I+F +RF+ +D     RL +L  E   L  S       N+ D++  L    R  LK   EVK   L+  KD+           KS+     +  +D +L    K E +  + +Y +ENI V       A  ETT  ++ +G+  L+ +PE+++KL  E+D V+GP       D   +PYL AV+ E  R    +P  + H    D    GY +P  + ++
Sbjct:  177 YNVISDILFHKRFDYKDQTSL-RLMSLFNENFYLLSSPWIQLYNNFPDYLQYLPGSHRKLLKNVSEVKSYALERVKDH----------QKSLEPSCPRGFLDTMLIEMAK-ERHSVDPMYTLENIAVTVADLLFAGTETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPSRIPAVKDRLDMPYLDAVVHEIQRFIDLLPSNLLHEATQDTVFRGYVIPKGTVVI 390          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
C515B_DICDI9.722e-1526.21Probable cytochrome P450 515B1 OS=Dictyostelium di... [more]
CP2L1_PANAR1.658e-1426.64Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 P... [more]
CP2R1_HUMAN2.166e-1426.89Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1... [more]
CP2DR_MESAU2.166e-1426.98Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CY... [more]
C7D95_MENGR2.166e-1426.51Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D... [more]
C71DD_MENPI2.166e-1427.11Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D... [more]
CP2DP_PIG2.829e-1423.53Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D... [more]
C99A2_ORYSJ2.829e-1428.13Cytochrome P450 99A2 OS=Oryza sativa subsp. japoni... [more]
CP2K4_ONCMY3.694e-1424.79Cytochrome P450 2K4 OS=Oncorhynchus mykiss GN=cyp2... [more]
CP2E1_BOVIN3.694e-1428.76Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top