FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2CN_RAT (Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.694e-14
Identity = 54/218 (24.77%), Postives = 103/218 (47.25%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQT--KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            N +  I+F+ RF+  D    N +  LN    ++   +   Y  +  I++     +++  K + +      K++ +E+ K+   +   +N  + + C +  I + +   K E + +N+     N+  A  ETT  ++ +G+  L+ +PE+Q K+  ELD V+G     +  D  KLPY  AV+ E  R    +P  +PH  + D K   Y +P  + +L
Sbjct:  180 NVICSILFNDRFQYNDKTFLNLMDLLNKNFQQVNSVWCQMYNLWPTIIKYLPGKHIEFAKRIDD-----VKNFILEKVKEHQKSLDPANPRDYIDCFLSKIEEEKDNLKSEFHLENLAVCGSNLFTAGTETTSTTLRFGLLLLMKYPEVQAKVHEELDRVIGRHQPPSMKDKMKLPYTDAVLHEIQRYITLLPSSLPHAVVQDTKFRDYVIPKGTTVL 392          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C7D94_MENGR (Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.694e-14
Identity = 44/166 (26.51%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  206 RRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            RRL    D F+EE +   + +    + +        D+  K  I  + +   + N   A  E +  +I W ++EL+ +P    K++ E+   L     +   +  +L Y+++V+KETLRL    P L+P  +  + ++ G+ +PA ++IL+NAW +   P  W+ P
Sbjct:  238 RRLDHVLDGFLEEHRVKKNGEFGGEDIVDVLFRMQKDSNIKIPITSNGIKGFIFNTFSAGAEASSTTISWALSELMRNPAKMAKVQAEVREALKGKTSVDLSEMQELKYMRSVVKETLRLHPPFP-LIPRQSREECEINGFYIPARTRILINAWSIGRDPLYWEDP 402          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2E1_MOUSE (Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.825e-14
Identity = 58/216 (26.85%), Postives = 97/216 (44.91%), Query Frame = 2
Query:   29 IMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINV-------AAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            I+F++RF+  D      +   N     L+  +   Y  F   L+     + K+ K V E R      Y + + K+    KS+     +   D +L    K E +    +Y +ENI+V       A  ETT  ++ +G+  L+ +PEI++KL  E+D V+GP       D   +PY+ AV+ E  R    +P  +PH    D    GY +P  + ++
Sbjct:  183 ILFNKRFDYDDKKCLELMSLFNENFYLLSTPWIQAYNYFSDYLQYLPGSHRKVMKNVSEIR-----QYTLGKAKE--HLKSLDINCPRDVTDCLLIEMEK-EKHSQEPMYTMENISVTLADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRAPAVRDRMNMPYMDAVVHEIQRFINLVPSNLPHEATRDTVFRGYVIPKGTVVI 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C7D95_MENSP (Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.825e-14
Identity = 43/166 (25.90%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  206 RRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            RR+    +  V+E K   S +    + +        D+Q K  I  + +   + +   A  ET+  +  W +AEL+ +P +  K + E+   L     +   D  +L Y+++V+KET+R+   IP L+P     + ++ GY +P +++I++N W +   P  W+KP
Sbjct:  240 RRVDTILEAIVDEHKLKKSGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTFSAGTETSSTTTLWVMAELMRNPAVMAKAQAEVRAALKGKTSVDVDDVQELKYMKSVVKETMRMHPPIP-LIPRSCREECEVNGYKIPNKARIMINVWSMGRNPLYWEKP 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C78AB_ORYSJ (Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 4.825e-14
Identity = 66/245 (26.94%), Postives = 115/245 (46.94%), Query Frame = 2
Query:   14 NNMYRIMFDRRFE--SQDDPLFNRLKALNGERSRLAQSFE----YNYGDFIPILRPFLRGYLKICKEVKER------RLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLG---GYDVPAESKILVNAWWLANXPAPWKKP 703
            NN+   +F RR++  S      +  + L   +S + + FE    +N+ D +P L      +L     V  R      R+Q F    + + +    + S + ++    +D +L  +    + ED+++ ++  +     +TT    EW +AE+V +P +Q +LR E+D  +G     ++ D  ++PYLQAV+KETLR     PLL     L  A +G   G  VPA +  +VN W + +    W  P
Sbjct:  225 NNIMGSVFGRRYDVSSSSGAAADEAEQL---KSMVREGFELLGAFNWSDHLPWL-----AHLYDPNHVARRCAALVPRVQAFVRGVIRDHRLRRDSSSTAADNADF-VDVLLSLEAHENLAEDDMVAVLWEMIFRGTDTTALVTEWCMAEVVRNPAVQARLRAEVDAAVGGDGCPSDGDVARMPYLQAVVKETLRAHPPGPLL-SWARLATADVGLANGMVVPAGTTAMVNMWAITHDGEVWADP 459          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C516A_DICDI (Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516a1 PE=3 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 6.302e-14
Identity = 52/192 (27.08%), Postives = 91/192 (47.40%), Query Frame = 2
Query:  131 NYGDFIPILRPFLR-GYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N  D  PIL  FL+   LK+   +++      +D   E R+KL       ++ L   I+ I  ++     +++ +  +  ++ ++  ET+  ++ W +  L+N+P  Q K+R EL    G    I   +  K P+  A IKE LR+R    L +P +   D   G Y +   S+I++N + LA  P  W+ P
Sbjct:  214 NVLDLFPILNIFLKKNKLKLVNNLQQV-WSYSQDSIKEHREKLLINPEKIDDLLDLFINEIKLSKNSEFFDDEGLYRVCSDLLLSGTETSSSTMSWLLLFLINNPNFQDKVRTELLEATGGKKTIGLTEKSKTPFFNACIKEALRIRPVGALSLPRIASEDVTCGPYTIEKGSQIIMNVYGLAMDPTVWEDP 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C82A3_SOYBN (Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.230e-14
Identity = 52/195 (26.67%), Postives = 87/195 (44.62%), Query Frame = 2
Query:  128 YNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEER-KKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVE-NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +   D +P LR   L G+ K  K   +   +L  ++  E R KKL      S+      +   L+    G  + D +       + +   ++T  ++ W ++ L+ +P    K + E+D  +G    I E D  KL YLQA++KETLRL    P   P     +  LGGY +   ++++ N W +   P+ W  P
Sbjct:  236 FTVADGVPCLRWLDLGGHEKAMKANAKEVDKLLSEWLEEHRQKKLLGENVESDRDFMDVMISALNGAQIGAFDADTICKATSLELILGGTDSTAVTLTWALSLLLRNPLALGKAKEEIDMQIGKDEYIRESDISKLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSVWSDP 430          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2C9_HUMAN (Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 1.075e-13
Identity = 60/222 (27.03%), Postives = 102/222 (45.95%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYI--VENINV----AAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  I+F +RF+ +D    N ++ LN     L+  +     +F PI+  F   + K+ K V        K Y +E+ K+   +  M+N   +  ID  L    K + N+ +   I  +EN  V    A  ETT  ++ + +  L+ HPE+  K++ E++ V+G        D   +PY  AV+ E  R    +P  +PH    D K   Y +P  + IL++
Sbjct:  176 NVICSIIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVA-----FMKSYILEKVKEHQESMDMNNP--QDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILIS 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C79F2_ARATH (Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 1.075e-13
Identity = 47/145 (32.41%), Postives = 69/145 (47.59%), Query Frame = 2
Query:  290 KCAIDHILDAQTKGEINEDNVLYIVENIN-------VAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            K A++  LD     +    N L   + I        +AAI+    ++EW + E++ +PEI +K   ELD V+G    + E D   L YL+A  +ET R+  +   + PH+   D  LGGY +P  S I V    L   P  WK P
Sbjct:  291 KAAVEDWLDTFITLKDQNGNYLVTPDEIKAQCVEFCIAAIDNPANNMEWTLGEMLKNPEILRKALKELDEVVGKDRLVQESDIRNLNYLKACCRETFRIHPSAHYVPPHVARQDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDP 435          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2E1_CANFA (Cytochrome P450 2E1 OS=Canis familiaris GN=CYP2E1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.404e-13
Identity = 54/219 (24.66%), Postives = 98/219 (44.75%), Query Frame = 2
Query:   11 YNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAST--KSMSNESLKCAIDHILDAQ--TKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            +N +  I+F + F+  D       K  N     L+  +   Y  F   L      + K+ + V E      KDY +E  K+   +   + S +   C +  +   +  T+     DN+   V ++  A  ETT  ++ +G+  L+ +PE+++KL  E+D V+GP       D  ++PY+ AV+ E  R    +P  +PH+   D    GY +P  + ++
Sbjct:  177 FNVIADILFHKHFDYSDQTGLRIQKLFNENFHLLSTGWLQLYNIFPSYLHYLPGSHRKVLRNVAE-----LKDYSLERVKEHQESLDPTCSRDFTDCLLQELQKERYGTEPWYTLDNIAVTVADLFFAGTETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPSRVPAIKDRLEMPYMDAVVHEIQRFIDLLPSNLPHVANQDTMFRGYVIPKGTVVI 390          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP2CN_RAT3.694e-1424.77Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c... [more]
C7D94_MENGR3.694e-1426.51Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D... [more]
CP2E1_MOUSE4.825e-1426.85Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1... [more]
C7D95_MENSP4.825e-1425.90Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D9... [more]
C78AB_ORYSJ4.825e-1426.94Cytochrome P450 78A11 OS=Oryza sativa subsp. japon... [more]
C516A_DICDI6.302e-1427.08Probable cytochrome P450 516A1 OS=Dictyostelium di... [more]
C82A3_SOYBN8.230e-1426.67Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=... [more]
CP2C9_HUMAN1.075e-1327.03Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1... [more]
C79F2_ARATH1.075e-1332.41Hexahomomethionine N-hydroxylase OS=Arabidopsis th... [more]
CP2E1_CANFA1.404e-1324.66Cytochrome P450 2E1 OS=Canis familiaris GN=CYP2E1 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top