FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71DF_MENPI (Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.395e-13
Identity = 43/166 (25.90%), Postives = 80/166 (48.19%), Query Frame = 2
Query:  206 RRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            RR+    +  V+E K   S +    + +        D Q K  I  +++   + +   A  ET+  +  W +AEL+ +P +  K + E+   L         D  +L Y+++V+KET+R+   IP L+P     +  + GY +P +++I++N W +   P  W+KP
Sbjct:  241 RRVDTILEAIVDEHKFKKSGEFGGEDIIDVLFRMQKDTQIKVPITTNSIKAFIFDTFSAGTETSSTTTLWVLAELMRNPAVMAKAQAEVRAALKEKTNWDVDDVQELKYMKSVVKETMRMHPPIP-LIPRSCREECVVNGYTIPNKARIMINVWSMGRNPLYWEKP 405          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_PAGMA (Cytochrome P450 1A1 OS=Pagrus major GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.127e-13
Identity = 53/215 (24.65%), Postives = 95/215 (44.19%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF----LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAW 667
            F RR++  +    N +      R  +A     N  DFIPIL+      ++ +L I     E   ++  +++    K   + + +++  +    D  +D     +   D ++ IV ++  A  +T   ++ W +  LV +PEIQ++L  E++TV+GP       D  +L   +A I E  R    +P  +PH    D  L GY +P    I +  W
Sbjct:  205 FGRRYDHNNRSWLNLVNPRRDVRKVVASG---NPADFIPILQYLPSTTMKKFLNINARFNEFVQKIVSEHYTTFNKD--NIRDITDSLIDHCEDEPMDPMPDAD---DKIVGIVNDLFGAGFDTISTALSWSVMYLVAYPEIQERLYQEMETVMGPDRMPCLSDRTQLTLPEAFILEIFRHSSFLPFTIPHCTTKDTSLNGYFIPKAPCIYIKQW 411          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C79F1_ARATH (Dihomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.127e-13
Identity = 66/245 (26.94%), Postives = 111/245 (45.31%), Query Frame = 2
Query:   26 RIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRP------FLRGYLKICKEVKERR----LQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVE---------NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            R++F RR  ++++   +  +  N E+  L   F  N  + +P   P      +LRG+    +E +       ++ + +  ++ER +L        E  K A++  LD  T   + + N  Y+V             +AAI+    ++EW + E++ +PEI +K   ELD V+G    + E D   L YL+A  +ET R+  +   +  H+   D  LGGY +P  S I V    L   P  WK P
Sbjct:  201 RMLFGRRHVTKENVFSDDGRLGNAEKHHLEVIF--NTLNCLPSFSPADYVERWLRGWNVDGQEKRVTENCNIVRSYNNPIIDERVQL-----WREEGGKAAVEDWLD--TFITLKDQNGKYLVTPDEIKAQCVEFCIAAIDNPANNMEWTLGEMLKNPEILRKALKELDEVVGRDRLVQESDIPNLNYLKACCRETFRIHPSAHYVPSHLARQDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDP 436          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2H1_CHICK (Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.085e-13
Identity = 60/222 (27.03%), Postives = 99/222 (44.59%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKAL--NGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENIN-------VAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKI 652
            N +  I+F  RF+ +D    + ++ L  N +     Q+  YN   F P +   L G  K   +  E      K+  +  ++   ++         C  D I     K E  ++N  + VE++        +A   TT  ++ +G+  L+ HPEI++K+  E+D V+G        D  +LPY  AVI E  R    +PL VPH  + D KL  Y +P ++ I
Sbjct:  179 NIICSIVFGDRFDYEDKKFLDLIEMLEENNKYQNRIQTLLYN---FFPTILDSLPGPHKTLIKNTETVDDFIKEIVIAHQESFDAS---------CPRDFIDAFINKMEQEKENSYFTVESLTRTTLDLFLAGTGTTSTTLRYGLLILLKHPEIEEKMHKEIDRVVGRDRSPCMADRSQLPYTDAVIHEIQRFIDFLPLNVPHAVIKDTKLRDYFIPKDTMI 388          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2E1_MACMU (Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.085e-13
Identity = 56/216 (25.93%), Postives = 97/216 (44.91%), Query Frame = 2
Query:   29 IMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINV-------AAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            I+F + F+  D+     +   N     L+  +   Y +F  +L      + K+ K V E      K+Y  E  K+    +S+     +   D +L    K + + +  LY ++ I V       A  ETT  ++ +G+  L+ +PEI++KL  E+D V+GP       D  ++PY+ AV+ E  R    +P  +PH    D    GY +P  + I+
Sbjct:  183 ILFRKHFDYNDEKFLRLMYLFNENFQLLSTPWLQLYNNFPSLLHYLPGSHRKVMKNVAE-----IKEYVSERVKE--HLQSLDPNCPRDLTDCLLVEMEKEKHSAER-LYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYIIPKGTVIV 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2D9_MOUSE (Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.085e-13
Identity = 55/232 (23.71%), Postives = 106/232 (45.69%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  ++F RRFE +D  L   LK L    + ++         F PIL    R   K  +  K   + +  +   E R      ++  N  ++    I+       +   N++N+L +V ++  A + TT  ++ W +  ++ HP++Q++++ E+D V+G        D   +PY  AVI E  R    +P+ +P +  HD ++  + +P  + +L N   +    + W+KP
Sbjct:  187 NVIASLIFARRFEYEDPFLIRMLKVLEQSLTEVSGLIPEVLNAF-PILLRIPRLADKALQGQKSF-IAILDNLLTENRTTWDPVQAPRNLTDAFLAQIEKA-KGNPESSFNDENLLMVVRDLFGAGMLTTSTTLSWALMLMILHPDVQRRVQQEIDEVIGQVRHPEMADQAHMPYTNAVIHEVQRFGDIVPVNLPRITSHDIEVQDFLIPKGTILLPNMSSMLKDESVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2CE_RABIT (Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.085e-13
Identity = 53/234 (22.65%), Postives = 106/234 (45.30%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQ--TKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  ++F  RF+ +D+   N +   N E  R+  S      +  PIL  +L G  K   E         +++ +E+ K+   +  ++N  + + C +  +   +   + E   +N++  V ++  A  ETT  ++ +G+  L+ HPE+  K++ E++ V+G        D  ++PY  A + E  R    +P  VPH    + K   Y +P  + +L +   + +    + KP
Sbjct:  176 NVICSVIFQNRFDYKDETFLNLMGKFN-ENFRILNSPWLQVCNIFPILMDYLPGTHKTVFE----NFDYVRNFVLEKTKEHQESLDINNPRDFIDCFLIKMKQEKHNQQSEFTIENLMATVTDVFAAGTETTSTTLRYGLLLLMKHPEVTAKVQEEIERVIGRHRSPCMQDRSRMPYTDATVHEIQRYINLVPNNVPHATTCNVKFRNYFIPKGTAVLTSLTSVLHDNQEFLKP 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C99A1_SORBI (Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bicolor GN=CYP99A1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.085e-13
Identity = 43/126 (34.13%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  329 GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVL-GPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            G I+  ++  I+ ++     ETT  + EW ++EL+  PE   K + E+   L G   +  E    KL Y + V+KE LRL   +PLL+P        +GG++V   +K++VNAW LA  P  W  P
Sbjct:  289 GGISTTSIKAILFDMLAGGTETTSSAAEWIMSELMRKPEAMAKAQAEVRGALDGKSPEDHEGQMDKLSYTRMVVKEGLRLHPVLPLLLPRSCQETCDVGGFEVTKGTKVIVNAWALARSPERWHDP 414          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2R1_MOUSE (Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.099e-13
Identity = 62/236 (26.27%), Postives = 106/236 (44.92%), Query Frame = 2
Query:   29 IMFDRRFESQDDPLFNRLKALNGERSRLAQS---FEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESL--KCAIDHILDAQTKGE------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            I+F  RF  +D   F  +  L  E   LA S   F YN   +I IL PF           K +RL    D   +   +L    +++ +       +D  LD   +G+       +++N+++ V  + +A  ETT   + W I  +  +P IQ ++  E+D ++G   + +     K+PY +AV+ E LR    +PL + H    DA + GY +P  + ++ N + +      WK P
Sbjct:  194 ILFGERFTYEDTD-FQHMIELFSENVELAASAPVFLYNAFPWIGIL-PF----------GKHQRLFRNADVVYDFLSRLIEKAAVNRKPHLPHHFVDAYLDEMDQGQNDPLSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVHKEIDLIVGHNRRPSWEYKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDP 417          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2K3_ONCMY (Cytochrome P450 2K3 OS=Oncorhynchus mykiss GN=cyp2k3 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.099e-13
Identity = 57/213 (26.76%), Postives = 97/213 (45.54%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL-DAQTKGE-------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGY 628
            N +  I++  RFE   DPLF  +     E   L  S      +  P L P++    ++ K + + ++++      E  + L  T  ++    +  +D  L   QT  E        ++DN+++ V N+  A  +TT  ++ WG+  +  +P IQ +++ E+  V+G    + E D   LPY  AVI ET RL    P+ +PH    D    GY
Sbjct:  188 NIISAIVYGSRFE-YTDPLFTGMADRAKESIHLTGSASIQMYNMFPWLGPWINNLTRLKKNIADMKMEV-----TELVRGLKET--LNPHMCRGFVDSFLVRKQTLEESGHMDSFYHDDNLVFSVGNLFSAGTDTTGTTLRWGLLLMTKYPHIQDQVQEEISGVIGSRQTLVE-DRKNLPYTDAVIHETQRLANIAPMSIPHTTSRDVTFQGY 391          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
C71DF_MENPI2.395e-1325.90Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D... [more]
CP1A1_PAGMA3.127e-1324.65Cytochrome P450 1A1 OS=Pagrus major GN=cyp1a1 PE=2... [more]
C79F1_ARATH3.127e-1326.94Dihomomethionine N-hydroxylase OS=Arabidopsis thal... [more]
CP2H1_CHICK4.085e-1327.03Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=... [more]
CP2E1_MACMU4.085e-1325.93Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE... [more]
CP2D9_MOUSE4.085e-1323.71Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1... [more]
CP2CE_RABIT4.085e-1322.65Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=C... [more]
C99A1_SORBI4.085e-1334.13Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bico... [more]
CP2R1_MOUSE9.099e-1326.27Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1... [more]
CP2K3_ONCMY9.099e-1326.76Cytochrome P450 2K3 OS=Oncorhynchus mykiss GN=cyp2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top