FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1B1_HUMAN (Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 9.099e-13
Identity = 55/239 (23.01%), Postives = 106/239 (44.35%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKG---------EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N M  + F  R+ S DDP F  L + N E  R   +   +  D +P L+ F      + +E ++     F ++ +++  +   +              IL A+ K           ++ +NV   + +I  A+ +T   +++W +     +P++Q +++ ELD V+G        D   LPY+ A + E +R    +P+ +PH    +  + GY +P ++ + VN W + + P  W  P
Sbjct:  203 NVMSAVCFGCRY-SHDDPEFRELLSHNEEFGRTVGAG--SLVDVMPWLQYFPNPVRTVFREFEQLNRN-FSNFILDKFLRHCESLRPGAAPRDMMDAFILSAEKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAELDQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVVFVNQWSVNHDPLKWPNP 437          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71A3_SOLME (Cytochrome P450 71A3 (Fragment) OS=Solanum melongena GN=CYP71A3 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.099e-13
Identity = 60/203 (29.56%), Postives = 98/203 (48.28%), Query Frame = 2
Query:    5 MMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF--LRGY-LKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVP 592
            + YN + R+   +++  + D      KA   +   L  +F  N GD+IP L     + G+  K+ K  K+  L  F ++ +E        +       K  +D +L+ Q   E    I  D++  ++ +   A  +T    +EW + EL+ HP   +KL+NE+  +     +ITE D   + YL+AVIKETLRL   IPLL+P
Sbjct:  172 LAYNIINRVALGKKYNDEIDA-----KATLDKFVELLGTF--NVGDYIPCLEWVNKITGFDSKVDKVAKD--LDTFLEFVIEAHMIRNEKEENRAGESKDLVDVLLEIQNGKETGFPIQRDSLKALLLDPFSAGTDTIYTVLEWTMTELLRHPRAMEKLQNEVQGLAQEKAEITEDDLPNMHYLKAVIKETLRLHPPIPLLLP 365          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DA_MOUSE (Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.188e-12
Identity = 55/233 (23.61%), Postives = 106/233 (45.49%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILR-PFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  ++F RRFE +D  L    K L    + ++         F  +LR P L G  K+ +  K   L + ++   E R      +   N  ++    I+ +     +   N++N+  +V ++  A + TT  ++ W +  ++ HP++Q++++ E+D V+G        D  ++PY  AVI E  R     PL +P +   D ++  + +P  S ++ N   +      W+KP
Sbjct:  187 NVIASLIFARRFEYEDPYLIRMQKVLEDSLTEISGLIPEVLNMFPILLRIPGLPG--KVFQGQKSL-LAIVENLLTENRNTWDPDQPPRNLTDAFLAEIEKV-KGNAESSFNDENLRMVVLDLFTAGMVTTSTTLSWALLLMILHPDVQRRVQQEIDAVIGQVRHPEMADQARMPYTNAVIHEVQRFGDIAPLNLPRITSRDIEVQDFLIPKGSILIPNMSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2D4_RAT (Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.188e-12
Identity = 33/126 (26.19%), Postives = 68/126 (53.97%), Query Frame = 2
Query:  326 KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +   N++N+  +V ++ +A + TT  ++ W +  ++ HP++Q +++ E+D V+G   +    D  ++P+  AVI E  R    +PL VPH    D ++ G+ +P  + ++ N   +      W+KP
Sbjct:  290 ESSFNDENLRVVVADLFMAGMVTTSTTLTWALLFMILHPDVQCRVQQEIDEVIGQVRRPEMADQARMPFTNAVIHEVQRFADILPLGVPHKTSRDIEVQGFLIPKGTTLITNLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A2_CHICK (Cytochrome P450 1A2 (Fragment) OS=Gallus gallus GN=CYP1A2 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.552e-12
Identity = 36/121 (29.75%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  344 DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLR-NELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + ++ +V +I  A  +T   ++ W +  LV  P  QKK++ +ELDT +G   +    +   LPY +A I ET+     +P  +PH    D  L G+ +P E  + VN W + +    W+ P
Sbjct:   42 EKIINLVNDIFGAGFDTVTTALSWSLMYLVTQPHSQKKIQESELDTAIGRERRSWLSERSMLPYKEAFILETVPTWQFVPFTIPHSTTRDTTLNGFHIPKECCVFVNQWQVNHEAELWEDP 162          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2CV_CAPAE (Cytochrome P450 2C31 (Fragment) OS=Capra aegagrus GN=CYP2C31 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.027e-12
Identity = 51/182 (28.02%), Postives = 88/182 (48.35%), Query Frame = 2
Query:  134 YGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINE------DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            +  F  +LR F   +  I K + E+R      + +EE KK   +  ++N   +  ID+ L    K + N+      DN++  V ++  A  ETT  ++ +G+  L+ HPE+  K++ E+D V+G        D  ++PY  AV+ E  R    +P  +PH+   D K   Y +P  + IL +
Sbjct:   10 FNAFPSLLRHFPGSHNTIFKNMTEQR-----KFILEEIKKHQESLDLNNP--QDFIDYFLIKMEKEKHNKHSEFTMDNLITTVWDVFSAGTETTSLTLRYGLLLLLKHPEVTAKVQEEIDRVVGRNRSPCMQDRSRMPYTDAVLHEIQRYIDLVPSNLPHVATQDVKFREYLIPKGTAILTS 184          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2E1_PIG (Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.648e-12
Identity = 55/215 (25.58%), Postives = 92/215 (42.79%), Query Frame = 2
Query:   29 IMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINE------DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            I+F + F+  D      +   N     L+  +   Y +F   LR     + K+ K + E      KDY +E  K      S+     +   D +L    K + +       DN+   V ++  A  ETT  ++ +G+  L+ +PE+++KL  E+D V+GP       D   +PYL AV+ E  R    IP  +PH    D     Y +P  + ++
Sbjct:  183 ILFRQHFDYNDKTCLRLMSMFNENFYLLSTGWIQLYNNFSGYLRYLPGSHRKLMKNISE-----IKDYALERVKD--HRDSLEPSCPRDFTDTLLMEMEKEKYSAEPIYTLDNIAVTVADMFFAGTETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPNRIPAIKDRLVMPYLDAVVHEIQRFIDLIPSNLPHEATRDTDFRDYIIPKGTVVI 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2E1_HUMAN (Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.648e-12
Identity = 55/210 (26.19%), Postives = 93/210 (44.29%), Query Frame = 2
Query:   29 IMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINV-------AAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVP 637
            I+F + F+  D+     +   N     L+  +   Y +F   L      + K+ K V E      K+Y  E  K+    +S+     +   D +L    K + + +  LY ++ I V       A  ETT  ++ +G+  L+ +PEI++KL  E+D V+GP       D  ++PY+ AV+ E  R    +P  +PH    D    GY +P
Sbjct:  183 ILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAE-----VKEYVSERVKE--HHQSLDPNCPRDLTDCLLVEMEKEKHSAER-LYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIP 384          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DQ_MOUSE (Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.648e-12
Identity = 33/126 (26.19%), Postives = 64/126 (50.79%), Query Frame = 2
Query:  326 KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +   N+ N+  +V ++ +A + TT  ++ W +  ++ HP++Q+++  E+D V+G        D  ++PY  AVI E  R    +P  +PHM   D K   + +P  + ++ N   +      W+KP
Sbjct:  290 ESSFNDKNLRIVVIDLFMAGMVTTSTTLSWALLLMILHPDVQRRVHQEIDEVIGHVRHPEMADQARMPYTNAVIHEVQRFADIVPTNLPHMTSRDIKFQDFFIPKGTTLIPNLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2B4_RABIT (Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.648e-12
Identity = 59/219 (26.94%), Postives = 102/219 (46.58%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTK------GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKI 652
            N +  I+F +RF+ +D P+F RL  L  +   L  SF     +  P    FL+ +    +++  R LQ    +  +  +K  +T   SN   +  ID  L    K       E +  N++  V ++  A  ETT  ++ +G   ++ +P + ++++ E++ V+G        D  K+PY  AVI E  RL   IP  VPH    D +  GY +P  +++
Sbjct:  177 NIICSIVFGKRFDYKD-PVFLRLLDLFFQSFSLISSFSSQVFELFP---GFLKHFPGTHRQIY-RNLQEINTFIGQSVEKHRATLDPSNP--RDFIDVYLLRMEKDKSDPSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEV 388          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP1B1_HUMAN9.099e-1323.01Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1... [more]
C71A3_SOLME9.099e-1329.56Cytochrome P450 71A3 (Fragment) OS=Solanum melonge... [more]
CP2DA_MOUSE1.188e-1223.61Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE... [more]
CP2D4_RAT1.188e-1226.19Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4... [more]
CP1A2_CHICK1.552e-1229.75Cytochrome P450 1A2 (Fragment) OS=Gallus gallus GN... [more]
CP2CV_CAPAE2.027e-1228.02Cytochrome P450 2C31 (Fragment) OS=Capra aegagrus ... [more]
CP2E1_PIG2.648e-1225.58Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 S... [more]
CP2E1_HUMAN2.648e-1226.19Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1... [more]
CP2DQ_MOUSE2.648e-1226.19Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE... [more]
CP2B4_RABIT2.648e-1226.94Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CY... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077; Name=FC931077; organism=Citrus clementina; type=EST; length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top