FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP18A_DROME (Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.648e-12
Identity = 60/238 (25.21%), Postives = 110/238 (46.22%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKER-RLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQTKGEI-----NEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  +M   RF S DDP F R   L  E  RL    E +  D+IP ++ F        K  + R  +Q F    +++ K+     ++ +  +   C I+      T  E+     +E+ ++ ++ ++  A +ET   ++ W    ++ +P+  +++++ELD V+G     T  D   LP  ++ I E++R    +PL   H    D +L GY +PA S ++     +   P  W+KP
Sbjct:  201 NVICSLMMSTRF-SIDDPKFRRFNFLIEEGMRLFG--EIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKP 435          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP10_LYMST (Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.648e-12
Identity = 60/231 (25.97%), Postives = 106/231 (45.89%), Query Frame = 2
Query:   26 RIMFDRRFESQDDPLFN-RLKALNGERSRLAQSFEYNYGDFIPILRPFLRGY--LKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILD-AQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGH-QITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            R +F    ES    LF  R+  L  E S +AQ+F  N   F   L+P +      K+      ++ + + D  ++  + L   K    +       H++      G ++   V  ++ ++ +AA+ETT  +  W +  L  +P++Q+KL  E+       +  I+  D  KLP ++AV+KETLRL   I          D +LGGY +PA + +  N + +   P+ + +P
Sbjct:  229 RELFKWAMESIGTFLFEERIGCLGQETSPMAQTFIANLEGFFKTLQPLMYNLPTYKLWSTKLWKQFENYSDNVIDIGRSLVEKKWHPCKMEVTQNLHLISYLVNNGSMSTKEVTGLIVDLMLAAVETTSSATVWCLYNLAKNPQVQEKLFQEITEAQAKNNGTISAEDLCKLPMVKAVVKETLRL-YPITYSTSRNIAEDMELGGYTIPAGTHVQANLYGMYRDPSLFPEP 458          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2CQ_MESAU (Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.458e-12
Identity = 56/223 (25.11%), Postives = 101/223 (45.29%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRG-YLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINE------DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  I+F  RF+ +D      +K LN E +R+  S  +   +  P+L  +  G + +I K +        + Y  E+ K+   +  ++N   +  ID+ L    +G  N+      +N+   V ++  A  ETT  ++ + +  L+ HP +  K++ E+D V+G        D   +PY  A+I E  R    IP  +PH    D K   Y +P  + I+ +
Sbjct:  176 NVICSIIFQNRFDYKDKDFLTFMKKLN-ENARILSSPWFQVCNNFPLLIDYCPGSHHRITKNIN-----YIRSYLSEKMKEHQESLDVANP--RDFIDYYLIKLKQGNYNQQSEFSPENLATTVSDLFAAGTETTSTTLRYALLLLLKHPHVTAKVQEEIDQVVGRHRNPCMQDRSHMPYTDAMIHEVQRFIDLIPTNLPHAVTCDIKFRDYFIPKGTTIITS 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2W1_HUMAN (Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 4.516e-12
Identity = 59/230 (25.65%), Postives = 100/230 (43.48%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N  + ++F RRF+ +D P+F  L  L  E   L  S      +  P L   L+ +  + ++++E R  L     +E R+            +   I        +G   E N +    ++ +A  ETT  +++W    +  HP++Q +++ ELD VLGPG      D   LPY  AV+ E  R    +P  VP     D +LGG+ +P  + ++     +      W+ P
Sbjct:  177 NITFALLFGRRFDYRD-PVFVSLLGLIDEVMVLLGSPGLQLFNVYPWLGALLQLHRPVLRKIEEVRAILRT--LLEARRPHVCPGDPVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLEDQQALPYTSAVLHEVQRFITLLP-HVPRCTAADTQLGGFLLPKGTPVIPLLTSVLLDETQWQTP 402          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DI_RAT (Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.516e-12
Identity = 32/126 (25.40%), Postives = 68/126 (53.97%), Query Frame = 2
Query:  326 KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +   N++N+  +V ++ +A + TT  ++ W +  ++  P++Q +++ E+D V+G   +    D  ++P+  AVI E  R    +PL VPH    D ++ G+ +P  + +++N   +      W+KP
Sbjct:  290 ESSFNDENLRVVVADLFMAGMVTTSTTLTWALLFMILRPDVQCRVQQEIDEVIGQVRRPEMADQARMPFTNAVIHEVQRFADILPLGVPHKTSRDIEVQGFLIPKGTTLIINLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2C2_RABIT (Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 4.516e-12
Identity = 56/222 (25.23%), Postives = 103/222 (46.40%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINE------DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  ++F  RF+  D    + +   N E  ++  S    + +  PIL  +  G  +  K VK   +   K+Y  E+ K+    KS+   + +  ID  L    + + N+      +N+L  V ++ +A  ETT  ++ +G+  L+ HPE+  K++ E++ V+G        D  ++PY  A + E  R    IP  VPH  + + K   Y +P  + +L +
Sbjct:  176 NVICSVIFQNRFDYTDQDFLSLMGKFN-ENFKILNSPWVQFCNCFPILFDYFPGSHR--KAVKN--IFYVKNYITEQIKE--HQKSLDINNPRDFIDCFLIKMEQEKCNQQSEFTIENLLTTVSDVFMAGTETTSTTLRYGLLLLMKHPEVIAKVQEEIERVIGRHRSPCMQDRSRMPYTDATVHEIQRYINLIPNNVPHTTICNLKFRNYLIPKGTDVLTS 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2G1_RAT (Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.898e-12
Identity = 50/212 (23.58%), Postives = 98/212 (46.23%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQTK--GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVP 637
            N +  ++F +RF+ +D    + +K +N     ++  +   Y  +  +++ F   + ++   ++E      KD+     K   ++   SN  + + C +  +   ++    E N  N++    N+  A  ET   ++ +G   L+ +PE++ K+  E++ V+G        D  K+PY  AVI E  RL   +PL VPH  + D    GY +P
Sbjct:  180 NVICSVVFGKRFDYEDQRFRSLMKMINESFVEMSMPWAQLYDMYWGVIQYFPGRHNRLYNLIEE-----LKDFIASRVKINEASFDPSNPRDFIDCFLIKMYQDKSDPHSEFNLKNLVLTTLNLFFAGTETVSSTLRYGFLLLMKYPEVEAKIHEEINQVIGTHRTPRVDDRAKMPYTDAVIHEIQRLTDIVPLGVPHNVIRDTHFRGYFLP 386          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2B5_RABIT (Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.898e-12
Identity = 58/219 (26.48%), Postives = 101/219 (46.12%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTK------GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKI 652
            N +  I+F +RF+ +D P+F RL  L  +   L  SF     +  P    FL+ +    +++  R LQ    +  +  +K  +T   SN   +  ID  L    K       E +  N++  V  +  A  ETT  ++ +G   ++ +P + ++++ E++ V+G        D  K+PY  AVI E  RL   +P   PHM   D +  GY +P  +++
Sbjct:  177 NIICSIVFGKRFDYKD-PVFLRLLDLFFQSFSLISSFSSQVFELFP---GFLKHFPGTHRQIY-RNLQEINTFIGQTVEKHRATLDPSNP--RDFIDVYLLRMEKDKSDPSSEFHHRNLILTVLTLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLVPFGAPHMVTKDTQFRGYVIPKNTEV 388          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2CK_MACFA (Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.703e-12
Identity = 55/218 (25.23%), Postives = 100/218 (45.87%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQT--KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            N +  ++F +RF+ +D+     +K        L   +     +F  ++  F   + K+ K V      L K Y  E+ K+  +T  ++N  + + C +  +   +   + E   +N++  V ++ VA  ETT  ++ +G+  L+ HPE+  K++ E+D V+G        D   +PY  AVI E  R    +P  VPH    D K   Y +P  + I+
Sbjct:  176 NVICSVVFQKRFDYKDENFLTLIKRFTVNFRILTSPWIQVCNNFPLLIDCFPGTHNKLLKNVA-----LTKSYIREKVKEHQATLDVNNPRDFIDCFLIKMEQEKDNQQSEFTIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVIHEIQRYIDLVPTGVPHAVTTDIKFRNYLIPKGTIII 388          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C519C_DICDI (Probable cytochrome P450 519C1 OS=Dictyostelium discoideum GN=cyp519c1 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.703e-12
Identity = 51/191 (26.70%), Postives = 91/191 (47.64%), Query Frame = 2
Query:  131 NYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINV--AAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ------ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLAN 679
            N  DFI ILRPF +   K       +  +  ++ +  ++  L   KS   + +   I++         + E  +  I   ++   A  +T   ++EW    L+N+P IQ+K  NEL +VLG  +       I+  +     YL  VIKE LR+R  +PL VP +   + ++ G+ +   ++IL NA+ +++
Sbjct:  225 NISDFIKILRPFFKNEYKKLNNSASKVFKFMEEIY--DQHLLKFDKSNPRDLMDYFIEYEFTNSPNTTLEEKKISIIKGCMSFVFAGDDTVAATLEWVCLYLINNPAIQEKCYNELISVLGDNNNESKIKFISLKERDNCQYLINVIKEVLRIRTPLPLSVPRIATQNCEINGFFIEKGTQILSNAFGMSH 413          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP18A_DROME2.648e-1225.21Cytochrome P450 18a1 OS=Drosophila melanogaster GN... [more]
CP10_LYMST2.648e-1225.97Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 P... [more]
CP2CQ_MESAU3.458e-1225.11Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CY... [more]
CP2W1_HUMAN4.516e-1225.65Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=2... [more]
CP2DI_RAT4.516e-1225.40Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d... [more]
CP2C2_RABIT4.516e-1225.23Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CY... [more]
CP2G1_RAT5.898e-1223.58Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1... [more]
CP2B5_RABIT5.898e-1226.48Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CY... [more]
CP2CK_MACFA7.703e-1225.23Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP... [more]
C519C_DICDI7.703e-1226.70Probable cytochrome P450 519C1 OS=Dictyostelium di... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top