FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C5142_DICDI (Probable cytochrome P450 514A2 OS=Dictyostelium discoideum GN=cyp514a2 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.006e-11
Identity = 50/189 (26.46%), Postives = 91/189 (48.15%), Query Frame = 2
Query:  134 YGDFIPILRPFLRGYLKICKEVKERRLQLF---KDYFVEERKKLASTKSMSN--------ESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNEL--DTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            Y D++P L P     L I    K   +  +   +DY  ++ +++   + + N         S    I+       +G I  D++L  + +I +A+++TT  SI + IA L NH EIQ K+  E+  + +    + I+  D  K PY+ +++ ET R   ++PL  P+M   D ++ GY +   ++I  N
Sbjct:  220 YSDYLPFLFP-----LDIKSMAKSNMISSYVFVRDYLAKKLEEVKKKEYIINGDDDGGVDTSQTPLIESYYKLYLQGLIGYDSILLSIVDIIIASVDTTSNSISFIIARLTNHQEIQSKIYEEIMSNDINNNSNNISFSDHSKYPYIISIMNETYRYYASVPLPEPNMTTEDIEVDGYKIAKGTQIYKN 403          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP4V3_MOUSE (Cytochrome P450 4V3 OS=Mus musculus GN=Cyp4v3 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.314e-11
Identity = 50/176 (28.41%), Postives = 88/176 (50.00%), Query Frame = 2
Query:  185 ICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTK--GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            I + VKER+ +  +D+    R  + S         K  +D +L    +    ++++++   V+       +TT  +I W +  L  +PE+Q+K+  ELD V G  H+ +T  D  KL YL  VIKETLR+  ++PL    ++  D ++GGY V   ++ ++  + L   P  +  P
Sbjct:  269 IAERVKERKAE--EDWTGAGRGPIPSKNKR-----KAFLDLLLSVTDEEGNRLSQEDIREEVDTFMFEGHDTTAAAINWSLYLLGTNPEVQRKVDQELDEVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLS-EDCEVGGYKVTKGTEAIIIPYALHRDPRYFPDP 436          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2CF_RABIT (Cytochrome P450 2C15 (Fragment) OS=Oryctolagus cuniculus GN=CYP2C15 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.314e-11
Identity = 51/218 (23.39%), Postives = 101/218 (46.33%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  I+F  RF+ +D+     ++  N E  R+  S      +  P+L  +L G          + ++  K++ +E+ K+   +  ++N  + + C +   +D +   E   ++++  V ++  A  ETT  ++   +  L+ HPE+  K++ E++ V+G        D  ++PY  AVI E  R    IP+ +PH    D K   Y +P    I+ +
Sbjct:   67 NVICSIIFHNRFDYKDEHFLKLMEKFN-ENVRILSSPWLQICNNFPVLTDYLPGI----HNTLVKNIEYTKNFIMEKVKEHQKSLDVNNPRDFIDCFLIK-MDQENHLEFTLESLVTTVSDLFGAGTETTSTTLSISLLLLLKHPEVAAKVQEEIERVIGRHRSPCMQDRSRMPYTDAVIHEIQRYIDLIPINLPHAVTRDIKFRNYFIPKGMNIITS 278          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2B9_MOUSE (Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.314e-11
Identity = 55/219 (25.11%), Postives = 104/219 (47.49%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINED------NVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKI 652
            N +  I+F  RF+  DD   + L  +    S L+ SF    G    +   FL+ +  + +++ +++ +L  DY     +K  +T   S  + +  ID  L    K + N +      N++  V ++     ETT  ++ +G+  ++ +P + +K++ E+D V+G     T  D  K+PY  AVI E  R    +P+ +PH  + D    GY +P  +++
Sbjct:  177 NIICSIVFGERFDYTDDQFLHLLNLMYKIFSLLS-SFS---GQMFELFSGFLKYFPGVHRQIVKKQQELL-DYIAHSVEKHKATLDPS--APRDYIDTYLLRMEKEKSNHNTEFHHQNLMMSVLSLFFVGTETTSATLHYGVLLMLKYPHVTEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPKNTEV 388          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2CS_MESAU (Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.716e-11
Identity = 57/223 (25.56%), Postives = 98/223 (43.95%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRG-YLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTK------GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  ++F  RF+  D    N ++ LN E   +  S      + IP    +L G + K  K   E      K Y ++  K+   T  M+N   +  ID  L    K       E   ++++  V ++ VA  ETT  ++ +G+  L+ H E+  K++ E+D V+G        D  ++PY  A++ E  R    IP  VPH    + K   Y +P  + ++ +
Sbjct:  176 NVICSVVFHNRFDYNDKNFLNLMEKLN-ENFEILNSPWLQVCNVIPAFLDYLPGSHNKALKNFAE-----IKSYILKRVKEHQETLDMNNP--RDFIDCFLIKMEKEKDNPHSEFTTESLMATVADVFVAGSETTSTTLRYGLLLLLKHKEVTAKVQKEIDHVIGRDRSPCMQDRTRMPYTDAMVHEVQRYVNLIPNNVPHAATCNVKFRNYVIPKGTDLITS 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2BB_CANFA (Cytochrome P450 2B11 OS=Canis familiaris GN=CYP2B11 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.716e-11
Identity = 64/239 (26.78%), Postives = 103/239 (43.10%), Query Frame = 2
Query:    5 MMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL------DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            M  N +  I+F +RF    DP F RL  L      L  SF         +   FL+ +    ++V    LQ  K +     +K   T   S  + +  ID  L       A+   E +  N++    ++  A  ETT  ++ +G   ++ +P I +++  E+D V+GP    +  D  K+PY  AVI E  R    +P+ VPHM   D    GY +P  +++        N P  ++KP
Sbjct:  174 MTANIICSIVFGKRF-GYKDPEFLRLMNLFYVSFALISSFS---SQMFELFHSFLKYFPGTHRQVYNN-LQEIKAFIARMVEKHRETLDPS--APRDFIDAYLIRMDKEKAEPSSEFHHRNLIDTALSLFFAGTETTSTTLRYGFLLMLKYPHIAERIYKEIDQVIGPHRLPSLDDRAKMPYTDAVIHEIQRFGDLLPIGVPHMVTKDICFRGYIIPKGTEVFPILHSALNDPHYFEKP 405          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2G1_RABIT (Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.927e-11
Identity = 53/214 (24.77%), Postives = 100/214 (46.73%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKG------EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVP 637
            N +  ++F  RF+ +D    + L+ +N     ++  +   Y  +  +++     + +I   ++E      KD F+  R K+ +  S+  ++ +  ID  L    +       E N  N++    N+  A  ET   ++ +G   ++ HPE+Q K+  E++ V+GP    +  D  K+P+  AVI E  RL   +P+ VPH  + D    GY +P
Sbjct:  180 NVISSVVFGSRFDYEDKQFLSLLRMINESFIEMSTPWAQLYDMYSGVMQYLPGRHNRIYYLIEE-----LKD-FIAARVKV-NEASLDPQNPRDFIDCFLIKMHQDKNNPHTEFNLKNLVLTTLNLFFAGTETVSSTLRYGFLLIMKHPEVQTKIYEEINQVIGPHRIPSVDDRVKMPFTDAVIHEIQRLTDIVPMGVPHNVIRDTHFRGYLLP 386          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2A9_MESAU (Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.927e-11
Identity = 53/219 (24.20%), Postives = 93/219 (42.47%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL------DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKI 652
            N +  ++F   F+ +D      L  +N      A      Y  F  +++       +I K  KE      +D+ + + K+  ST  ++  S +  ID  L            E N  N++    N+  A  ET   +I +G   L+ +PE++ K+  E+D V+G   Q    D  K+PY +AVI E  R     PL +P   + +    G+ +P ++ +
Sbjct:  179 NVISSVVFGDAFDYEDKEFLELLHMMNEMNKFAASPVGQLYDMFHSVMKYLPGPQQQIIKNTKE-----LEDFMIRKVKQNQSTLDLN--SARNFIDSFLIHMHEEKKNPTSEFNIKNLVMTSLNLFFAGSETVSSTIRYGFLLLMKYPEVEAKVHEEIDRVIGRNRQPQFEDRMKMPYTEAVINEIQRFANLAPLGIPRKTIKNTTFRGFFLPKDTDV 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2C5_RABIT (Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.823e-11
Identity = 46/218 (21.10%), Postives = 100/218 (45.87%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  ++F  RF+ +D+     +++LN     L+  +   Y +F     P L  Y     +   +     K++ +E+ K+      ++N  + + C +   ++ +   E   ++++  V ++  A  ETT  ++ + +  L+ HPE+  +++ E++ V+G        D  ++PY  AVI E  R    +P  +PH    D +   Y +P  + I+ +
Sbjct:  176 NVICSVIFHNRFDYKDEEFLKLMESLNENVRILSSPWLQVYNNF-----PALLDYFPGIHKTLLKNADYIKNFIMEKVKEHQKLLDVNNPRDFIDCFLIK-MEQENNLEFTLESLVIAVSDLFGAGTETTSTTLRYSLLLLLKHPEVAARVQEEIERVIGRHRSPCMQDRSRMPYTDAVIHEIQRFIDLLPTNLPHAVTRDVRFRNYFIPKGTDIITS 387          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2B6_HUMAN (Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.823e-11
Identity = 52/236 (22.03%), Postives = 105/236 (44.49%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL------DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I+F +RF  QD      L       S ++  F   +  F   L+ F   + ++ K ++E  +  +  + VE+ ++     ++   + K  ID  L       +    E +  N+     ++  A  ETT  ++ +G   ++ +P + +++  E++ V+GP       D  K+PY +AVI E  R    +P+ VPH+        GY +P ++++ +      + P  ++KP
Sbjct:  177 NIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQE--INAYIGHSVEKHRE-----TLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKP 405          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
C5142_DICDI1.006e-1126.46Probable cytochrome P450 514A2 OS=Dictyostelium di... [more]
CP4V3_MOUSE1.314e-1128.41Cytochrome P450 4V3 OS=Mus musculus GN=Cyp4v3 PE=1... [more]
CP2CF_RABIT1.314e-1123.39Cytochrome P450 2C15 (Fragment) OS=Oryctolagus cun... [more]
CP2B9_MOUSE1.314e-1125.11Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=2... [more]
CP2CS_MESAU1.716e-1125.56Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CY... [more]
CP2BB_CANFA1.716e-1126.78Cytochrome P450 2B11 OS=Canis familiaris GN=CYP2B1... [more]
CP2G1_RABIT2.927e-1124.77Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CY... [more]
CP2A9_MESAU2.927e-1124.20Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP... [more]
CP2C5_RABIT3.823e-1121.10Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CY... [more]
CP2B6_HUMAN3.823e-1122.03Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top