FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_SHEEP (Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.334e-23
Identity = 69/233 (29.61%), Postives = 113/233 (48.50%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKL---ASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I F RR++  DD  F  L  L+ E   +  S   N  DFIP+LR      L + K++  RR  +F    V+E  K       + +++  ++   D  LD     +++++ ++ +V ++  A  +T   +I W +  LV  P +QKK++ ELDTV+G        D  +LPYL+A I ET R    +P  +PH    D  L G+ +P    + VN W + +    W+ P
Sbjct:  203 NVICAICFGRRYD-HDDQEFLSLINLSNEFGEITASG--NPADFIPVLRYLPNTALDLFKDLN-RRFYVFVQKIVKEHYKTFEKGHIRDITDSLIEHCQDKRLDENANIQLSDEKIINVVMDLFGAGFDTVTTAISWSLLYLVTSPRVQKKIQEELDTVIGRARWPQLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTNLNGFYIPKGXCVFVNQWQINHDQKLWEDP 431          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.354e-23
Identity = 71/236 (30.08%), Postives = 109/236 (46.19%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRR-FESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + + N + R M  RR F +  D   +  +++  E   LA  F  N GDF+P L    L+G     K + +R          E        K     S   ++         G + +  +  ++ N+  A  +T+  +++W IAEL+ HP+I  K + ELD V+G    + E D  +LPYLQAVIKE  RL    PL +PH+     ++ GY +P  S +L N W +A  P  W  P
Sbjct:  176 MCVVNALGREMIGRRLFGADADHKADEFRSMVTEMMALAGVF--NIGDFVPSLDWLDLQGVAGKMKRLHKRFDAFLSSILKEHEMNGQDQKHTDMLSTLISLKGTDLDGDGGSLTDTEIKALLLNMFTAGTDTSASTVDWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDP 409          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71B3_ARATH (Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 5.686e-23
Identity = 59/158 (37.34%), Postives = 92/158 (58.23%), Query Frame = 2
Query:  254 LASTKSMSNESLKCAIDHILDAQTKGEINE------DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLG--PGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            L + +  +N+     ID IL+   K E +E      D++  I++NI +A ++T+  ++ W +AELV +P + KK + E+ T +G     +I E D  KL YL+ VIKETLRL    PLL+P   + D K+ GYD+P ++ +LVNAW +   P  W+ P
Sbjct:  256 LKNPEDKTNQDRPDIIDSILETIYKQEQDESFKLTIDHLKGIIQNIYLAGVDTSAITMIWAMAELVKNPRVMKKAQEEIRTCIGIKQKERIEEEDVDKLQYLKLVIKETLRLHPPAPLLLPRETMADIKIQGYDIPRKTILLVNAWSIGRNPELWENP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP17A_ICTPU (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 7.427e-23
Identity = 68/201 (33.83%), Postives = 104/201 (51.74%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKI---CKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEIN----------EDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D  P L+ F    L+I   C  ++++ LQ  K Y  EE K        S+   +   D +L A+   E N          +D++L  V +I  A +ETT   ++W I  L++HP++Q+K++ ELD  +G        D   LPYL+A I+E LR+R   PLL+PH+ L DA +G Y V   ++++VN W L +    WK P
Sbjct:  221 DIFPWLQLFPNEDLRILRRCVSIRDKLLQ--KKY--EEHKA-----DFSDNIQRDLFDALLRAKNSSENNNTSTQDVGLTDDHLLMTVGDIFGAGVETTTTVLKWSILYLIHHPQVQRKIQEELDAKIGRDRHPQVNDRGNLPYLEATIREVLRIRPVSPLLIPHVALSDANIGEYTVQKGTRVIVNLWSLHHDEKEWKNP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP17A_RANDY (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 9.699e-23
Identity = 71/241 (29.46%), Postives = 118/241 (48.96%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEIN-----------EDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F+ R++  D      LK   G    +A+    +  D  P L+ F    L I ++    R QL +    E +       +   E++K  +D +L A+   E N           ED++L  V +I  A +ETT   ++W +A L+++PE+QKK++ ELD  +G G      D   L Y +A I E LR+R   PLL+PH+ L ++ +G Y +P E+++++N W L +    W  P
Sbjct:  191 NVVCSLCFNTRYKRGDAEFETMLKYSKGIVDTVAKD---SLVDIFPWLQIFPNKDLDILRQSVAARDQLLQKKINEHKD------AFCGETVKDLVDALLKAKLNMENNNSNVSQDVGLTEDHILMTVGDIFGAGVETTSTVLKWAVAYLLHYPEVQKKIQEELDVKVGFGRYPLLSDRKILHYTEAAISEVLRIRPVSPLLIPHVALKESSIGEYTIPKEARVVINLWSLHHDEKEWVNP 422          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_RAT (Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.267e-22
Identity = 65/232 (28.02%), Postives = 107/232 (46.12%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAS--TKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I F RR++  D  L + +   N         +     DFIPILR      L   K++ ++     K    E  +       + +++  ++   D  LD     ++++D V+ IV ++  A  +T   +I W +  LV +P IQ+K++ ELDTV+G   Q    D  +LPYL+A I ET R    +P  +PH  + D  L G+ +P    + VN W + +    W  P
Sbjct:  200 NVICAICFGRRYDHDDQELLSIVNLSNEFGEVTGSGYP---ADFIPILRYLPNSSLDAFKDLNKKFYSFMKKLIKEHYRTFEKGHIRDITDSLIEHCQDRRLDENANVQLSDDKVITIVFDLFGAGFDTITTAISWSLMYLVTNPRIQRKIQEELDTVIGRDRQPRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTIRDTSLNGFYIPKGHCVFVNQWQVNHDQELWGDP 428          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_CAVPO (Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.654e-22
Identity = 72/233 (30.90%), Postives = 110/233 (47.21%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKL---ASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I F +R+ S DD     L  LN E   +  S   N  DFIPILR      +   K++  RR  +F    ++E  K       + +++  ++   D  LD     +I++  ++ IV ++  A  +T   +I W +  LV +P IQKK++ ELDTV+G   Q    D  KLPY++A I E  R    +P  +PH    D  L G+ +P    I VN W + +    W  P
Sbjct:  192 NVISAICFGQRY-SHDDQQLLELIDLNNEFGEVTGSG--NPSDFIPILRYLPSATMDTFKDLN-RRFSVFIQKMIKEHYKTFEKGHIRDITDSLIEHCQDRKLDKNANIQISDQKIIGIVLDLFGAGFDTITTAISWSLLYLVMNPRIQKKIQEELDTVIGRERQPQLADRPKLPYMEAFISEVFRYSSFMPFTIPHSTTKDTSLNGFYIPKGCCIFVNQWQINHDQKLWGDP 420          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP17A_ONCMY (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.654e-22
Identity = 62/196 (31.63%), Postives = 104/196 (53.06%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFK--------DYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D  P L+ F    L++ K+    R +L +        DY   E++ L      +  S +      +  +T G ++ED++L  V +I  A +ETT   ++W IA L++HP++Q++++ ELD+V+G        D   LPYL+A I+E LR+R   PLL+PH+   D  +G + V   ++I++N W L +    WK P
Sbjct:  222 DIFPWLQVFPNADLRLLKQCVSIRDKLLQKKYEEHKSDYSDHEQRDLLDALLRAKRSAENNNTAEITMETVG-LSEDHLLMTVGDIFGAGVETTSTVLKWAIAYLIHHPQVQQRIQEELDSVVGGDRTPQLSDRGSLPYLEATIREVLRIRPVAPLLIPHVAQTDTSIGKFTVRKGARIIINLWSLHHDEKEWKNP 416          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C81F1_ARATH (Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 1.654e-22
Identity = 66/244 (27.05%), Postives = 120/244 (49.18%), Query Frame = 2
Query:    5 MMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYG---------DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLY--IVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + +NN+ R++  +R+   D          N E + L +   Y+           D++PIL+ F   + K  K + +    + +    E R+         ++     ++H++  Q +      +V+   ++ ++ +A  ET+  ++EW +A L+ +PE+ +K R+E+D  +G    I E D   LPYLQ V+ ET RL    P L+P     D K+GGYDVP ++ ++VNAW +   P  W++P
Sbjct:  181 LTFNNIVRMVTGKRYYGDD--------VNNKEEAELFKKLVYDIAMYSGANHSADYLPILKLFGNKFEKEVKAIGKSMDDILQRLLDECRR---------DKEGNTMVNHLISLQQQQPEYYTDVIIKGLMMSMMLAGTETSAVTLEWAMANLLRNPEVLEKARSEIDEKIGKDRLIDESDIAVLPYLQNVVSETFRLFPVAPFLIPRSPTDDMKIGGYDVPRDTIVMVNAWAIHRDPEIWEEP 407          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71C2_MAIZE (Cytochrome P450 71C2 OS=Zea mays GN=CYP71C2 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.654e-22
Identity = 68/200 (34.00%), Postives = 110/200 (55.00%), Query Frame = 2
Query:  128 YNYGDFIPILRPFLRGYLKICKEVKERRL-QLFKDYFVEE-RKKLASTKSMSNESLKCAIDHIL-DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGH-----QITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +N  D+ P         L++   VK RRL Q + D F E  ++ + S  S  +E  +    H+L   Q +  +  DN+  I+ ++  A IET+  ++E+G+AEL+N+  + +KL+ E+ T +G         + E D   +PYL+A IKETLRL    P L+PH +  D+++ GY VPA +++LV+AW L      W+KP
Sbjct:  246 FNLEDYFPPNMAMADVLLRLVS-VKARRLNQRWNDVFDELIQEHVQSRPSGESEESEADFIHVLLSIQQEYGLTTDNLKAILVDMFEAGIETSYLTLEYGMAELINNRHVMEKLQTEVRTTMGSPDGKKLDMLAEEDLGSMPYLKATIKETLRLHPPAPFLLPHYSTADSEIDGYFVPAGTRVLVHAWALGRDRTTWEKP 444          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP1A1_SHEEP3.334e-2329.61Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 S... [more]
F3PH_ARATH4.354e-2330.08Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C71B3_ARATH5.686e-2337.34Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CY... [more]
CP17A_ICTPU7.427e-2333.83Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalu... [more]
CP17A_RANDY9.699e-2329.46Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana d... [more]
CP1A1_RAT1.267e-2228.02Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1... [more]
CP1A1_CAVPO1.654e-2230.90Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 P... [more]
CP17A_ONCMY1.654e-2231.63Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorh... [more]
C81F1_ARATH1.654e-2227.05Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CY... [more]
C71C2_MAIZE1.654e-2234.00Cytochrome P450 71C2 OS=Zea mays GN=CYP71C2 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top