FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1B1_MOUSE (Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.823e-11
Identity = 57/243 (23.46%), Postives = 110/243 (45.27%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF---LRGYLKICKEVKERRLQLFKDYFVEERKKL---ASTKSMSNESLKCAIDHILDAQTKGEINEDN-------VLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N M  + F  R+ + DD  F  L + N E  R   +   +  D +P L+ F   +R   +  +++         D F+  R+ L   A+ + M++  +  A     + +  G+  +D+       V   + +I  A+ +T   ++ W +     +P++Q +++ ELD V+G        D   LPY+ A + E++R    +P+ +PH    +  + GY +P  + + VN W + + PA W  P
Sbjct:  203 NVMSAVCFGCRY-NHDDAEFLELLSHNEEFGRTVGAG--SLVDVLPWLQLFPNPVRTTFRKFEQLNRNFSNFVLDKFLRHRESLVPGAAPRDMTDAFILSA-----EKKASGDPGDDSSGLDLEDVPATITDIFGASQDTLSTALLWLLILFTRYPDVQARVQAELDQVVGRDRLPCMSDQPNLPYVMAFLYESMRFSSFLPVTIPHATTANTFVLGYYIPKNTVVFVNQWSVNHDPAKWPNP 437          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP255_MOUSE (Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.993e-11
Identity = 54/221 (24.43%), Postives = 103/221 (46.61%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRG-YLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQTK--GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  ++F  RF+ +D+   N ++ LN E  ++  S      + +P L  +L G + K+ K   E      K Y +   K+   T  M N  + + C +  +   +     E   ++++  V +I VA  ETT  ++ +G+  L+ H E+  K++ E+D V+G        D  ++PY  A++ E  R    IP  VPH    + +   Y +P  ++++ +
Sbjct:  176 NVICSVIFHNRFDYKDEKFLNLMERLN-ENFKILNSPWMQVYNALPTLINYLPGSHNKVIKNFTE-----IKSYILGRVKEHQETLDMDNPRDFIDCFLIKMEQEKHNPHSEFTIESLMATVTDIFVAGTETTNITLRYGLLLLLKHTEVTAKVQAEIDHVIGRHRSPCMQDRTRMPYTDAMVHEIQRYIDLIPNNVPHAATCNVRFRSYFIPKGTELVTS 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: ORDA_ASPFN (O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.521e-11
Identity = 34/105 (32.38%), Postives = 55/105 (52.38%), Query Frame = 2
Query:  389 ETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +TT+ ++      +  +PE+Q+K R ELD V+GP    T     +LP++ A++KE  R   A PL  PH+   D    GY +P  + +L N W   + P+ +  P
Sbjct:  304 DTTVSAVSSFFVAMALYPEVQRKAREELDRVVGPTTLATFEHRSQLPFIDALVKEVFRWHPASPLGAPHITQEDQIWDGYLLPKGALLLPNIWTFTHDPSVYHDP 408          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: ORDA_ASPFL (O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 6.521e-11
Identity = 34/105 (32.38%), Postives = 55/105 (52.38%), Query Frame = 2
Query:  389 ETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +TT+ ++      +  +PE+Q+K R ELD V+GP    T     +LP++ A++KE  R   A PL  PH+   D    GY +P  + +L N W   + P+ +  P
Sbjct:  304 DTTVSAVSSFFVAMALYPEVQRKAREELDRVVGPTTLATFEHRSQLPFIDALVKEVFRWHPASPLGAPHITQEDQIWDGYLLPKGALLLPNIWTFTHDPSVYHDP 408          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2D3_RAT (Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 6.521e-11
Identity = 54/236 (22.88%), Postives = 100/236 (42.37%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILR--PFLRGYLKICKEV--KERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  +++ RRF+  D      LK L        +S     G F  +L   P L     +  +V   ++      D  V E KK         +     +  I  A+   E   N+ N+  +V ++  A + TT  ++ W +  ++ HP++Q +++ E+D V+G        D   +P+  AVI E  R    +P+ +PH    D ++ G+ +P  + ++ N   +      W+KP
Sbjct:  187 NVIASLIYARRFDYGDPDFIKVLKILK-------ESMGEQTGLFPEVLNMFPVLLRIPGLADKVFPGQKTFLTMVDNLVTEHKKTWDPDQPPRDLTDAFLAEIEKAKGNPESSFNDANLRLVVNDLFGAGMVTTSITLTWALLLMILHPDVQCRVQQEIDEVIGQVRHPEMADQAHMPFTNAVIHEVQRFADIVPMNLPHKTSRDIEVQGFLIPKGTTLIPNLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2CP_MESAU (Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.521e-11
Identity = 56/223 (25.11%), Postives = 102/223 (45.74%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRG-YLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL------DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  I+F  RF+ +D      +K +N E  R+  S      +  P L  +  G + KI K V        K Y +E+ ++    +S+  E+ +  ID+ L      +   + E + +N+   V ++  A  ETT  ++ + +  L+ HP +  K++ E+D V+G   +    D   +PY  A+I E  R    IP+ +PH    D K   Y +P  + ++ +
Sbjct:  176 NVICSIIFQNRFDYKDQDFLTFMKKVN-ENVRILSSPWLQVCNNFPSLIDYCPGSHHKITKNVN-----YLKKYILEKIEE--HQESLDIENPRDFIDYYLIKLKQANHNQQSEFSLENLTTTVSDLFGAGTETTSTTLRYALLLLLKHPHVTAKVQEEIDQVVGRHRKPCMQDRSHMPYTDAMIHEVQRFIDLIPISLPHAVTCDIKFRDYFIPKGTTVITS 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2AA_RABIT (Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.521e-11
Identity = 53/236 (22.46%), Postives = 104/236 (44.07%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL------DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I+F  RF+ +D    + L+ + G     A      Y  F  +++     +L   ++   + L+  +D+  ++ ++  + +++   S +  ID  L          K E +  N++    N+  A  ET   ++ +G   L+ HP+++ K+  E+D V+G   Q    D  K+PY +AVI E  R    IP+ + H    D K   + +P  +++      +   P  + KP
Sbjct:  180 NVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATPTGQLYEMFYSVMK-----HLPGPQQQAFKELEGLRDFIAKKVER--NQRTLDPNSPRDFIDSFLIRMQEEKKDPKSEFHMKNLVMTTLNLFFAGTETVSTTMRYGFLLLMKHPDVEAKVHEEIDRVIGRNRQPKFEDRAKMPYTEAVIHEIQRFTDMIPMGLAHRVTRDTKFRDFLLPKGAEVFPMLGSVLKDPKFFSKP 408          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP255_RAT (Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 6.521e-11
Identity = 51/221 (23.08%), Postives = 103/221 (46.61%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRG-YLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQ--TKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  ++F  RF+ +D+   N ++ LN E  ++  S      + +P    +L G + ++ K   E      K Y +   K+   T  M N  + + C +  +   +   + E   ++++  V ++ VA  ETT  ++ +G+  L+ H E+  K++ E+D V+G   +    D  ++PY  A++ E  R    IP  VPH    + +   Y +P  + ++ +
Sbjct:  176 NVICSVVFHNRFDYKDENFLNLMEKLN-ENFKILNSPWMQVCNALPAFIDYLPGSHNRVIKNFAE-----IKSYILRRVKEHQETLDMDNPRDFIDCFLIKMEQEKHNPRTEFTIESLMATVSDVFVAGSETTSTTLRYGLLLLLKHTEVTAKVQEEIDHVIGRHRRPCMQDRTRMPYTDAMVHEIQRYINLIPNNVPHAATCNVRFRNYVIPKGTDLVTS 390          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP4X1_RAT (Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.517e-11
Identity = 45/160 (28.12%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  236 VEERKKLASTKSMSNESLKCA--IDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +++RKK    +   +++      +D +L AQ   E   ++ ++   V     A  + +  SI W +  L  +PE Q + R E+ ++LG G  IT     ++PY    IKETLRL   IP +   ++       G+ +PA   ++++ W L + PA WK P
Sbjct:  262 IQDRKKTLKDQVNQDDTQTSQNFLDIVLSAQAGDEKAFSDADLRSEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITWEQLDEIPYTTMCIKETLRLIPPIPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWKDP 421          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2AD_HUMAN (Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 8.517e-11
Identity = 53/219 (24.20%), Postives = 98/219 (44.75%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVE------NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKI 652
            N +  I+F  RF+ +D    + L+ + G     A S    Y  F  +++     +L   ++   + LQ  +D+    +K   + +++   S +  ID  L    + E N +   Y+        N+  A  ET   ++ +G   L+ HPE++ K+  E+D V+G   Q    D  K+PY +AVI E  R    +P+ + H    D K   + +P  +++
Sbjct:  180 NVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMK-----HLPGPQQQAFKELQGLEDFIA--KKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEV 391          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP1B1_MOUSE3.823e-1123.46Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=2... [more]
CP255_MOUSE4.993e-1124.43Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE... [more]
ORDA_ASPFN6.521e-1132.38O-methylsterigmatocystin oxidoreductase OS=Aspergi... [more]
ORDA_ASPFL6.521e-1132.38O-methylsterigmatocystin oxidoreductase OS=Aspergi... [more]
CP2D3_RAT6.521e-1122.88Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3... [more]
CP2CP_MESAU6.521e-1125.11Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CY... [more]
CP2AA_RABIT6.521e-1122.46Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=C... [more]
CP255_RAT6.521e-1123.08Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c... [more]
CP4X1_RAT8.517e-1128.13Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1... [more]
CP2AD_HUMAN8.517e-1124.20Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top