FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP17A_CHICK (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.161e-22
Identity = 59/198 (29.80%), Postives = 103/198 (52.02%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEIN----------EDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D  P L+ F    L + K   + R QL +  F E ++      +   ++++  +D +L  +   E N          +D++L  V +I  A +ETT   ++W +  L+++PE+QKK++ E+D  +G        D   LPYL+A I E LR+R   PLL+PH++L D  +G Y +P  +++++N W + +    W KP
Sbjct:  221 DIFPWLQIFPNRDLALLKRCLKVRDQLLQQKFTEHKE------AFCGDTVRDLMDALLQVRLNAENNSPLEPGLELTDDHLLMTVGDIFGAGVETTTTVLKWAVLYLLHYPEVQKKIQEEMDQKIGLARHPHLSDRPLLPYLEATISEGLRIRPVSPLLIPHVSLADTSIGEYSIPKGARVVINLWSVHHDEKEWDKP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BO_ARATH (Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.161e-22
Identity = 54/143 (37.76%), Postives = 87/143 (60.84%), Query Frame = 2
Query:  299 IDHILDAQTKGEINE------DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLG--PGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ID +LD   K E  +      DN+  I+++I +A ++T+  ++ W +AELV +P + KK+++E+ T +G     +I E D  KL YL+ V+KETLRL  A PLL+P   +   K+ GY++P+++ +LVN W +   P  WK P
Sbjct:  268 IDSLLDMIRKQEQGDSFKLTIDNLKGIIQDIYLAGVDTSAITMIWAMAELVKNPRVMKKVQDEIRTCIGIKQNEKIEEDDVDKLQYLKLVVKETLRLHPAAPLLLPRETMSQIKIQGYNIPSKTILLVNVWSIGRDPKHWKNP 410          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BP_ARATH (Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.686e-22
Identity = 58/143 (40.56%), Postives = 87/143 (60.84%), Query Frame = 2
Query:  278 NESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLG-PGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ++S K  IDH+     KG         I ++I +A I+T+  ++ W +AELVN+P + KK+++E+ + +G    +I E D  KL YL+ VIKETLRL  A PLL+P   + D K+ GYD+P ++ +LV+AW L   P  WK P
Sbjct:  285 DKSFKLTIDHL-----KG---------ITQDIFLAGIDTSAITMIWAMAELVNNPRVMKKVQDEIRSCIGIKKERIEEEDVGKLQYLKLVIKETLRLHPAAPLLLPRETMADIKIQGYDIPRKTLLLVSAWSLGRDPKYWKNP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71B4_ARATH (Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 3.686e-22
Identity = 59/173 (34.10%), Postives = 95/173 (54.91%), Query Frame = 2
Query:  209 RLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDA------QTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ--ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            R+  F ++ V++     +T+   +      +D ILD           ++  D++  ++ NI  A I+T+  ++ W +AELV +P + KK ++E+ T +G   +  I E D  KL YL+ V+KETLRL  A PLL+P   + D K+ GYD+P +  +LVNAW +   P  WK P
Sbjct:  247 RVDTFFNHIVDDHHSKKATQDRPD-----MVDAILDMIDNEQQYASFKLTVDHLKGVLSNIYHAGIDTSAITLIWAMAELVRNPRVMKKAQDEIRTCIGIKQEGRIMEEDLDKLQYLKLVVKETLRLHPAAPLLLPRETMADIKIQGYDIPQKRALLVNAWSIGRDPESWKNP 414          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.814e-22
Identity = 60/197 (30.46%), Postives = 100/197 (50.76%), Query Frame = 2
Query:  131 NYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDA--------QTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            N GDFIP L    L+G  +  K+   R    F +  ++E    AST         C +  I+D          T  ++  + +  I   +  A +ET+   +EW ++EL+ HP   KKL+ E+++V+G    + E D   + YL  V+KETLRL  ++PL +PH +L    +GGY +P ++ +++N W +   P+ W
Sbjct:  230 NIGDFIPYLDCLDLQGIKRALKKANAR-FDAFAEKMIDEHIN-ASTIRNGEADAGCHVKDIIDVLLEMAKNDNTGAKVTREIIKAITYELFSAGMETSANVLEWAMSELLRHPHAMKKLQQEIESVVGQQGTVKESDLASIVYLHCVVKETLRLYPSLPLALPHESLEAVTVGGYYIPKKTMVIMNLWAIGRDPSVW 424          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71DA_SOYBN (Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.814e-22
Identity = 62/222 (27.93%), Postives = 118/222 (53.15%), Query Frame = 2
Query:   83 KALNGERSRLAQSF------------EYNYGDFIPILRPF----LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            +A  G++SR  Q F             ++  D  P  R F      G L+    V +R LQ      ++E K   +  S   E+++  +D +L  Q + E  + +DN+  ++++I +   ET+   +EWG++EL+ +P + ++ + E+  V      + E + H+L YL+++IKET+RL   +PLLVP ++    ++ GY++P++++I++NAW +   P  W
Sbjct:  200 RAAFGKKSRYQQVFISNMHKQLMLLGGFSVADLYPSSRVFQMMGATGKLEKVHRVTDRVLQ----DIIDEHKN-RNRSSEEREAVEDLVDVLLKFQKESEFRLTDDNIKAVIQDIFIGGGETSSSVVEWGMSELIRNPRVMEEAQAEVRRVYDSKGYVDETELHQLIYLKSIIKETMRLHPPVPLLVPRVSRERCQINGYEIPSKTRIIINAWAIGRNPKYW 416          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_BALAC (Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.287e-22
Identity = 69/234 (29.49%), Postives = 111/234 (47.44%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHI----LDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F RR++ +   L + +  L+ E   +A S   N  DFIPILR      L   K++  RR  +F    ++E  K    K    +     I+H     LD     +++++ ++ +V ++  A  +T   +I W +  LV  P +QKK++ ELDTV+G   Q    D  +LPYL+A I ET R    +P  +PH    D  L G+ +P    + VN W + +    W  P
Sbjct:  200 NVICAMCFGRRYDHESQVLLS-VVGLSNEFGAVAASG--NPADFIPILRYLPNTALDDFKDLN-RRFYIFMQKMLKEHYKTFE-KGRIRDITDSLIEHCQGKRLDENANIQLSDEKIVNVVMDLFGAGFDTVTTAISWSLMYLVTSPSVQKKIQEELDTVIGSARQPRLSDRPRLPYLEAFILETFRHSSFLPFTIPHSTTRDTSLNGFYIPKGRCVFVNQWQINHDQKLWDDP 428          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71DC_CATRO (Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.287e-22
Identity = 63/205 (30.73%), Postives = 107/205 (52.20%), Query Frame = 2
Query:  125 EYNYGDFIPILRPFLRGYLKICKEVKERRLQLFK--DYFVE-----ERKKLASTKSMSN-ESLKCAIDHILDAQTKGE----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            E N  D  P L+     +L++    K +  ++ K  D  VE      ++K+    S  N E  +  +D +L+ Q + +    + + N+  I+ NI  A  ET+  +++W + E++ +P + KK + E+  V      + E   H+L YLQAVIKETLRL   +PLL+P       K+ GY +P++S+++VNAW +   P  W +P
Sbjct:  205 EPNIADMFPSLK-----FLQLISTSKYKIEKIHKQFDVIVETILKGHKEKINKPLSQENGEKKEDLVDVLLNIQRRNDFEAPLGDKNIKAIIFNIFSAGTETSSTTVDWAMCEMIKNPTVMKKAQEEVRKVFNEEGNVDETKLHQLKYLQAVIKETLRLHPPVPLLLPRECREQCKIKGYTIPSKSRVIVNAWAIGRDPNYWIEP 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AK_ARATH (Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 8.211e-22
Identity = 71/229 (31.00%), Postives = 119/229 (51.97%), Query Frame = 2
Query:   26 RIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF--LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQT----KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            R+   R++  + D +       N  R+  A   E+  G++IP L     +RG L    EV ++R   F +  V+E ++         E+    +D +L  Q+    + E+ +  +  I+ ++ +A   TTL  +EW + EL+ +P++ KKL+ E+ +       +TE +  K+ YLQAVIKE LRLR   PLLVP +   D KL GY++PA ++++VNAW +      W
Sbjct:  187 RVALGRKYSGKKDGI----DVENIVRTFAALLGEFPVGEYIPSLSWIDRIRG-LDHKMEVVDKRFDEFLERVVKEHEEA------DKETRSDLVDKLLTIQSDKTGQFELEKSALKLIIWDMFLAGTATTLSFLEWAMTELMRNPKVMKKLQEEIRSSSPQDLFVTEKEAEKMNYLQAVIKEALRLRPPAPLLVPRVLSEDVKLKGYNIPAGTQVIVNAWAIQRDTTTW 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_MOUSE (Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 1.072e-21
Identity = 62/232 (26.72%), Postives = 106/232 (45.69%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAS--TKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I F +R++  D  L + +   N         +     DFIP+LR      L   K++ ++     K    E  +       + +++  ++   D  LD     ++++D V+ IV ++  A  +T   +I W +  LV +P +Q+K++ ELDTV+G   Q    D  +LPYL+A I ET R    +P  +PH    D  L G+ +P    + VN W + +    W  P
Sbjct:  200 NVICAICFGQRYDHDDQELLSIVNLSNEFGEVTGSGYP---ADFIPVLRYLPNSSLDAFKDLNDKFYSFMKKLIKEHYRTFEKGHIRDITDSLIEHCQDRKLDENANVQLSDDKVITIVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGRDRQPRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTSLNGFYIPKGCCVFVNQWQVNHDRELWGDP 428          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP17A_CHICK2.161e-2229.80Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus... [more]
C71BO_ARATH2.161e-2237.76Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=C... [more]
C71BP_ARATH3.686e-2240.56Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=C... [more]
C71B4_ARATH3.686e-2234.10Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CY... [more]
C75A1_PINTA4.814e-2230.46Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 P... [more]
C71DA_SOYBN4.814e-2227.93Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 P... [more]
CP1A1_BALAC6.287e-2229.49Cytochrome P450 1A1 OS=Balaenoptera acutorostrata ... [more]
C71DC_CATRO6.287e-2230.73Tabersonine 16-hydroxylase (Fragment) OS=Catharant... [more]
C71AK_ARATH8.211e-2231.00Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=C... [more]
CP1A1_MOUSE1.072e-2126.72Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top