FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C79A1_SORBI (Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP79A1 PE=1 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 1.072e-21
Identity = 70/235 (29.79%), Postives = 115/235 (48.94%), Query Frame = 2
Query:   14 NNMYRIMFDRRF--ESQDDPLFNRLKALNGER--SRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N + R+MF+RR+  E Q D     ++ L+ +   + L   + +   D++P LR   L G+ KI KE      +L      +  ++  S +    E     +  + DAQ    +  + V    ++I  AA++    ++EW +AE+VN+PE+  K   ELD V+G    + E D  KL Y++A I+E  RL    P  VPH+ L D  + GY VP  S ++++   L   P  W +P
Sbjct:  224 NVIRRLMFNRRYFGEPQADGGPGPMEVLHMDAVFTSLGLLYAFCVSDYLPWLRGLDLDGHEKIVKEANVAVNRLHDTVIDDRWRQWKSGERQEMEDFLDVLITLKDAQGNPLLTIEEVKAQSQDITFAAVDNPSNAVEWALAEMVNNPEVMAKAMEELDRVVGRERLVQESDIPKLNYVKACIREAFRLHPVAPFNVPHVALADTTIAGYRVPKGSHVILSRTGLGRNPRVWDEP 458          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C76C2_ARATH (Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.072e-21
Identity = 59/181 (32.60%), Postives = 99/181 (54.70%), Query Frame = 2
Query:  167 LRGYLKICKEVKERRLQLFKDYFVEE--RKKLASTKSMSNESLKCAIDHILDAQT--KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWK 697
            L+G  K  K   ER  ++F+ +   +   K L  T S      +  +D +LD     + E+N +++++++ ++  A  +T   ++EW +AEL+ +PE   K + E+D V+G    + E D   LPYLQAV+KET RL  A PLLVP     D ++ G+ VP ++++ VN W +   P  W+
Sbjct:  238 LQGNRKTLKACSERLFKVFRGFIDAKLAEKSLRDTNSKDVRE-RDFVDVLLDLTEGDEAELNTNDIVHLLLDLFGAGTDTNSSTVEWAMAELLRNPETMVKAQAEIDCVIGQKGVVEESDISALPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVFVNVWAIGRDPNVWE 417          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_CANFA (Cytochrome P450 1A1 OS=Canis familiaris GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.401e-21
Identity = 63/233 (27.04%), Postives = 110/233 (47.21%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKL---ASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F +R++  D  L + +   N     +A +   N  DF PILR      L   K++  +R   F    V+E  K       + +++  ++   D  LD     +++++ ++ +V ++  A  +T   +I W +  LV +P +QKK++ ELDTV+G   Q    D  +LPY++A I ET R    +P  +PH    D  L G+ +P    + VN W + +    W  P
Sbjct:  200 NVICAMCFSKRYDHDDQELLSLVNLSNEFGEGVASA---NPLDFFPILRYLPNPALDFFKDLN-KRFYSFMQKMVKEHYKTFEKGQIRDVTDSLIEHCQDKRLDENANIQLSDEKIVNVVLDLFGAGFDTVTTAISWSLLYLVTNPNVQKKIQKELDTVIGRARQPRLSDRPQLPYMEAFILETFRHASFVPFTIPHSTTRDTSLSGFYIPKGRCVFVNQWQINHDQKLWGNP 428          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C83A1_ARATH (Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 1.829e-21
Identity = 64/230 (27.83%), Postives = 113/230 (49.13%), Query Frame = 2
Query:   26 RIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-----LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ--ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            R  F +++    + +   +K L G +S L + F   + DF P          L  Y+K C E ++  +Q   +  ++ ++    T+SM    +   +    +     E   DNV  ++ +I VA  +T   ++ WG+  L+ +P++ KK + E+   +       +TE D   LPY +A++KETLR+   IPLL+P   + D K+ GYD+PA + + VNAW ++     W
Sbjct:  184 RQAFGKKYNEDGEEMKRFIKILYGTQSVLGKIF---FSDFFPYCGFLDDLSGLTAYMKECFERQDTYIQEVVNETLDPKRVKPETESM----IDLLMGIYKEQPFASEFTVDNVKAVILDIVVAGTDTAAAAVVWGMTYLMKYPQVLKKAQAEVREYMKEKGSTFVTEDDVKNLPYFRALVKETLRIEPVIPLLIPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKEW 406          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP21A_MOUSE (Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3)

HSP 1 Score: 102.449 bits (254), Expect = 2.389e-21
Identity = 60/188 (31.91%), Postives = 99/188 (52.66%), Query Frame = 2
Query:  146 IPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAST--KSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            IP+LR      L+  K+++E R  + K    + +  L +   K M +  L+  ++   D + +  ++E +V   V ++ +   ETT  ++ W +A L++HPEIQK+L+ ELD  LGPG Q+   +  +LP L A I E LRLR  +PL +PH     + + GYD+P +  I+ N          W+ P
Sbjct:  207 IPLLRFLPNPGLQKLKQIQESRDHIVKQQLKQHKDSLVAGQWKDMIDYMLQ-GVEKQRDGKDEERLHEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQKRLQEELDLKLGPGSQLLYRNRMQLPLLMATIAEVLRLRPVVPLALPHRATRASSISGYDIPKDMVIIPNIQGANLDEMVWELP 393          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_PLEPL (Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.120e-21
Identity = 62/227 (27.31%), Postives = 114/227 (50.22%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF----LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F RR++  D  L + L  L+ E  R+  S   N  DFIPIL+      ++ +L+I +   E   ++  +++    K   + + +++  +    D  LD  +  +++++ ++ IV ++  A  +T   ++ W +  LV HPEIQ++L  E++  +G        D   LP+L+A I E LR    +P  +PH    D  L GY +P ++ + +N W + + P  WK P
Sbjct:  208 FGRRYDHDDQELVS-LVTLSDEFGRVVGSG--NPADFIPILQYLPSAEMKNFLRINEHFTEFVQKIVTEHYTTFNKD--NIRDITDSLIDHCEDRKLDENSNVQMSDEKIVGIVNDLFGAGFDTVSTALSWSVMYLVAHPEIQERLYQEIEDKVGLDRMPLLSDKPNLPFLEAFILEILRHSSFLPFTIPHCTTKDTSLNGYFIPKDTCVFINQWQINHDPELWKDP 429          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C75A3_PETHY (Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.075e-21
Identity = 58/193 (30.05%), Postives = 101/193 (52.33%), Query Frame = 2
Query:  128 YNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +N GDFIP L    L+G  K  K + ++   L    F +E K  +  +    + L C +++  D      ++  N+  ++ N+  A  +T+  +IEW +AE++ +P I KK + E+D V+G   ++ E D   LPYL+A+ KET R   + PL +P ++     + GY +P  +++ VN W +   P  W+ P
Sbjct:  218 FNIGDFIPCLAWMDLQGIEKGMKRLHKKFDALLTKMF-DEHKATSYERKGKPDFLDCVMEN-RDNSEGERLSTTNIKALLLNLFTAGTDTSSSAIEWALAEMMKNPAILKKAQGEMDQVIGNNRRLLESDIPNLPYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPEVWENP 408          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.322e-21
Identity = 69/237 (29.11%), Postives = 117/237 (49.37%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQD----DPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKL-ASTKSMSNESLKCAIDHILDAQTKG-EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N + R+M  +R  +      DP     K++  E   +A  F  N GDFIP L    ++G     K++  R      D   E + K+    K + +  +    D   DA   G ++ +  +  ++ N+ VA  +T+  ++EW IAEL+ +P+I  + + E+D V+G    + E D  +L YL+A++KET RL  + PL +P +     ++ GY +P  S +L+N W +A  P  W  P
Sbjct:  180 NALARVMLGKRVFADGSGDVDPQAAEFKSMVVEMMVVAGVF--NIGDFIPQLNWLDIQGVAAKMKKLHARFDAFLTDILEEHKGKIFGEMKDLLSTLISLKND---DADNDGGKLTDTEIKALLLNLFVAGTDTSSSTVEWAIAELIRNPKILAQAQQEIDKVVGRDRLVGELDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLLNVWAIARDPNAWADP 411          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71B2_ARATH (Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 5.322e-21
Identity = 60/201 (29.85%), Postives = 103/201 (51.24%), Query Frame = 2
Query:  128 YNYGDFIP-----ILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE---INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLG-PGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + + DF P      +    + + KI K  KE  L  F  + +++  K    K   N+ +   I  ++D Q   +   +N DN+  IV ++ +A I+T+  ++ W + EL+ +P + KK +  + T LG    +ITE D  K+ YL  ++KET RL  A+P +VP   +   K+ GYD+P +++I +N W +   P  W  P
Sbjct:  217 FTFSDFFPGGLGRFVDWLFQRHKKINKVFKE--LDAFYQHVIDDHLKPEGRK---NQDIVTLILDMIDKQEDSDSFKLNMDNLKAIVMDVFLAGIDTSAVTMIWAMTELIRNPRVMKKAQESIRTTLGLKKERITEEDLGKVEYLNHILKETFRLHPALPFVVPRETMSHIKIQGYDIPPKTQIQLNVWTIGRDPKRWNDP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP21A_RAT (Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 6.951e-21
Identity = 68/225 (30.22%), Postives = 109/225 (48.44%), Query Frame = 2
Query:   50 ESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL-------DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + QD  L N   +   +  +    +     D IP LR F    L   K+ +E R     D+ V +  K      ++ +  K  ID++L       DA+  G+++E +V   V ++ V   ETT  ++ W +A L++HPEIQK+L+ ELD  L P  Q+   +  +LP L A I E LRLR  +P+ +PH     + + GYD+P ++ I+ N          W+ P
Sbjct:  178 DKQDSTLLNATHSCVRDLLKAWNHWSVQILDIIPFLRFFPNPGLWKLKQFQESR-----DHIVMQELKRHKDSLVAGQ-WKDMIDYMLQGVEKQRDARDPGQLHERHVHMSVVDLFVGGTETTAATLSWAVAFLLHHPEIQKRLQEELDLKLAPSSQLLYKNRMQLPLLMATIAEVLRLRPVVPMALPHRATKASSISGYDIPKDTIIIPNIQGANLDEMVWELP 396          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
C79A1_SORBI1.072e-2129.79Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP... [more]
C76C2_ARATH1.072e-2132.60Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CY... [more]
CP1A1_CANFA1.401e-2127.04Cytochrome P450 1A1 OS=Canis familiaris GN=CYP1A1 ... [more]
C83A1_ARATH1.829e-2127.83Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CY... [more]
CP21A_MOUSE2.389e-2131.91Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE... [more]
CP1A1_PLEPL3.120e-2127.31Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cy... [more]
C75A3_PETHY4.075e-2130.05Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida G... [more]
F3PH_PETHY5.322e-2129.11Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
C71B2_ARATH5.322e-2129.85Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CY... [more]
CP21A_RAT6.951e-2130.22Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top