FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_PLAFE (Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.078e-21
Identity = 62/227 (27.31%), Postives = 112/227 (49.34%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF----LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F RR++  D  L   L  L+ E  R+  S   N  DFIPIL+      ++ +L+I     E   ++  +++    K   + + +++  +    D  LD  +  +++++ ++ IV ++  A  +T   ++ W +  LV HPEIQ++L  E++  +G        D   LP+L+A I E LR    +P  +PH    D  L GY +P ++ + +N W + + P  WK P
Sbjct:  208 FGRRYDHDDQELVG-LVTLSDEFGRVVGSG--NPADFIPILQYLPSAAMKNFLRINSRFTEFVQKIVTEHYTTFDKD--NIRDITDSLIDHCEDRKLDENSNVQMSDEKIVGIVNDLFGAGFDTVSTALSWSVMYLVAHPEIQERLYQEIEDKVGLDRMPLLSDKPNLPFLEAFILEILRHSSFLPFTIPHCTTKDTSLNGYFIPKDTCVFINQWQINHDPELWKDP 429          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_FELCA (Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.078e-21
Identity = 64/233 (27.47%), Postives = 108/233 (46.35%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKL---ASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F RR++  D  L + +   N      A     N  DF PILR      L   K+V E+   +F    V+E  K       + +++  ++   D  LD     +++++ ++ +V ++  A  +T   +I W +  LV  P +Q+K++ ELDTV+G   Q    D  +LPY++A I E  R    +P  +PH    D  L G+ +P E  + VN W + +    W  P
Sbjct:  201 NVICAMCFGRRYDHDDQELLSIVNLSNEFGDGTASG---NPVDFFPILRYLPNPALDFFKDVNEK-FSIFIHKMVKEHYKTFEKGHIRDITDSLIEHCQDKRLDENANIQLSDEKIVNVVSDLFGAGFDTVTTAISWCLMYLVTSPNVQEKIQKELDTVIGRERQPRLSDRLQLPYMEAFILEMFRHTSFVPFTIPHSTTKDTSLSGFYIPKERCVFVNQWQINHDQKLWGDP 429          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71C3_MAIZE (Cytochrome P450 71C3 OS=Zea mays GN=CYP71C3 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.078e-21
Identity = 58/156 (37.18%), Postives = 84/156 (53.85%), Query Frame = 2
Query:  242 ERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGH--QITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            E +KL+  K   ++     ID  L    +     DNV  ++ N+  AAIET+   +E  +AEL+NH  + KKL+ E+           I E D   LPYL+A +KE LRL    PLL+PH +  D ++ GY +PA  ++LVN W +   PA W+KP
Sbjct:  287 EMRKLSGDKEKESDDF---IDIFLSRYEEYGFTMDNVKSLLMNVFEAAIETSYLVLESAMAELMNHRRVMKKLQAEVRAYGAEKKLDMIREDDLSSLPYLKASMKEALRLHPPGPLLLPHYSTADCQIDGYHIPANPRVLVNGWAIGRDPAVWEKP 439          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_MICTO (Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.186e-20
Identity = 61/225 (27.11%), Postives = 106/225 (47.11%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLA--STKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F RR+  +D  L + L  L  E  ++  S   N  DFIP+LR      +K    + ER +   +    E        + + +++  +    D  LD  +  +++++ ++ IV ++  A  +T   ++ W +  LV HPEIQ++L  E+   +G        D H LP L+A I E  R    +P  +PH    D  L GY +P ++ + +N W + + P  WK+P
Sbjct:  204 FGRRYGHEDQELLS-LVNLTDEFGKVVGSG--NLADFIPLLRFLPNATMKRFMAINERFMTFVQKIVTEHYNTYDKDNIRDITDSLIDHCEDRKLDENSNIQMSDEKIVGIVNDLFGAGFDTVSTALSWSVMYLVAHPEIQERLHQEIKDKVGLSRSPVLTDRHNLPILEAFIFEIFRHSSFLPFTIPHCATKDTSLDGYFIPKDTCVFINQWQINHDPELWKEP 425          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_LIMLI (Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.186e-20
Identity = 62/227 (27.31%), Postives = 112/227 (49.34%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF----LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F RR++  D  L   L  L+ E  R+  S   N  DFIPIL+      ++ +L+I     E   ++  +++    K   + + +++  +    D  LD  +  +++++ ++ IV ++  A  +T   ++ W +  LV HPEIQ++L  E++  +G        D   LP+L+A I E LR    +P  +PH    D  L GY +P ++ + +N W + + P  WK P
Sbjct:  208 FGRRYDHDDQELVG-LVTLSDEFGRVVGSG--NPADFIPILQYLPSATMKNFLRINGRFTEFVQKIVTEHYTTFDKD--NIRDITDSLIDHCEDRKLDENSNVQMSDEKIVGIVNDLFGAGFDTVSTALSWSVMYLVAHPEIQERLYQEIEDKVGLDRMPLLSDKPNLPFLEAFILEILRHSSFLPFTIPHCTTKDTSLNGYFIPKDTCVFINQWQINHDPEMWKDP 429          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP17A_ORYLA (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.549e-20
Identity = 61/202 (30.20%), Postives = 100/202 (49.50%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEIN--------------EDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D  P L+ F    L++ K+    R QL +  F E +         S+   +  +D +L A+   E N              +D++L  V +I  A +ETT   ++W I  L+++PE+QK+++ ELD  +G        D   LP+L+A I+E LR+R   PLL+PH+ L D  LG + V   +++++N W L +    W  P
Sbjct:  223 DIFPWLQIFPNKDLRLLKQCVAVRDQLLQKKFEEHKS------DYSDHVQRDLLDALLRAKRSAENNNTAAEFSAEAVGLSDDHLLMTVGDIFGAGVETTTTVLKWAITYLIHYPEVQKQIQEELDRKVGVDRPPQLSDRGSLPFLEATIREVLRIRPVAPLLIPHVALSDTSLGDFTVRKGTRVVINLWSLHHDEKEWTNP 418          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AQ_ARATH (Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.549e-20
Identity = 45/121 (37.19%), Postives = 74/121 (61.16%), Query Frame = 2
Query:  332 EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            EIN  ++  IV N+ V   +T+   +EW + EL+ HP+  K+L+ E+ T+      ++E +   + YL+AVIKE LRL   +PL+VPH +  D +LG + +PA +++L+NAW +    A W
Sbjct:  275 EINRVSIKAIVMNVFVGGTDTSSTLMEWAMTELLRHPKCLKRLQEEVRTICKDKSSVSEEEIQNMSYLKAVIKEALRLHPPLPLMVPHESTQDVRLGDHHIPAGTQVLINAWAIGREAATW 395          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_RABIT (Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.022e-20
Identity = 67/232 (28.88%), Postives = 109/232 (46.98%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAS--TKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F RR++  D  L + L  LN E  ++A S   +  DF  ILR      L   K++ ER     ++   E  +       + +++  +K      LD     +++++  + IV ++  A  +T   +I W +  LV  P IQ+K++ ELD V+G   +    D  +LPYL+AVI ET R    +P  +PH    D  LGG+ +P    + VN W   + P  W  P
Sbjct:  200 NVICAMCFGRRYDHDDQELLS-LVNLNDEFGKVAASG--SPADFFLILRYLPNPALDTFKDLNERFYSFTQERVKEHCRSFEKGHIRDITDSLIKHYRVDRLDENANVQVSDEKTVGIVLDLFGAGFDTVTTAISWSLMYLVTKPRIQRKIQEELDAVVGRARRPRFSDRPQLPYLEAVIMETFRHTSFLPFTIPHSTTRDTSLGGFYIPKGRCVFVNQWQNNHDPELWGDP 428          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C79B3_ARATH (Tryptophan N-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.022e-20
Identity = 61/225 (27.11%), Postives = 107/225 (47.56%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKL-ASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F  + E+   P    ++ ++     L  +F +   D++P+L    L G+ KI +E     +  + D  ++ER K+    K    E        I D   +  +  D +   ++ + +AA +    ++EW IAE++N PEI  K   E+D V+G    + E D  KL Y++A+I+E  RL       +PH+ L D  + GY +P  S++L++ + L   P  W  P
Sbjct:  222 FSEKTEADGGPTLEDIEHMDAMFEGLGFTFAFCISDYLPMLTGLDLNGHEKIMRE-SSAIMDKYHDPIIDERIKMWREGKRTQIEDFLDIFISIKDEAGQPLLTADEIKPTIKELVMAAPDNPSNAVEWAIAEMINKPEILHKAMEEIDRVVGKERFVQESDIPKLNYVKAIIREAFRLHPVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDP 445          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_HUMAN (Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.641e-20
Identity = 63/232 (27.16%), Postives = 107/232 (46.12%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAS--TKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I F RR++     L + L  LN     +  S   N  DFIPILR      L   K++ E+     +    E  K       + +++  ++   +  LD     +++++ ++ IV ++  A  +T   +I W +  LV +P +Q+K++ ELDTV+G   +    D   LPY++A I ET R    +P  +PH    D  L G+ +P    + VN W + +    W  P
Sbjct:  196 NVICAICFGRRYDHNHQELLS-LVNLNNNFGEVVGSG--NPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNP 424          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP1A1_PLAFE9.078e-2127.31Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a... [more]
CP1A1_FELCA9.078e-2127.47Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 ... [more]
C71C3_MAIZE9.078e-2137.18Cytochrome P450 71C3 OS=Zea mays GN=CYP71C3 PE=2 S... [more]
CP1A1_MICTO1.186e-2027.11Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1... [more]
CP1A1_LIMLI1.186e-2027.31Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 P... [more]
CP17A_ORYLA1.549e-2030.20Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzia... [more]
C71AQ_ARATH1.549e-2037.19Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=C... [more]
CP1A1_RABIT2.022e-2028.88Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CY... [more]
C79B3_ARATH2.022e-2027.11Tryptophan N-hydroxylase 2 OS=Arabidopsis thaliana... [more]
CP1A1_HUMAN2.641e-2027.16Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top