FC931172
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC931172 vs. ExPASy Swiss-Prot
Match: P2C13_ORYSJ (Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.767e-12 Identity = 34/86 (39.53%), Postives = 52/86 (60.47%), Query Frame = 1 Query: 445 GLVKFGFSLVKGKANHPMEDYHVAKFVQLQGHELGLFAIYDGHLGETVPAYLQKHLFSNILKEEEFWVDPQRSISKAYEKTDQAIL 702 G +K G+S +GK MED++ K ++ G + LF ++DGH G YL+++LF N+LK EF D + +IS+ Y+KTD L Sbjct: 108 GKLKCGYSSFRGK-RATMEDFYDVKLTEIDGQAVSLFGVFDGHGGPRAAEYLKENLFENLLKHPEFLTDTKLAISETYQKTDTDFL 192
BLAST of FC931172 vs. ExPASy Swiss-Prot
Match: P2C52_ORYSJ (Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.587e-11 Identity = 32/86 (37.21%), Postives = 51/86 (59.30%), Query Frame = 1 Query: 445 GLVKFGFSLVKGKANHPMEDYHVAKFVQLQGHELGLFAIYDGHLGETVPAYLQKHLFSNILKEEEFWVDPQRSISKAYEKTDQAIL 702 G + G+S +GK MED++ K ++ ++ LF I+DGH G YL++HLF N++K EF + + +IS+ Y+KTD L Sbjct: 226 GFLSCGYSSFRGK-RASMEDFYDIKSSKIDDKQISLFGIFDGHGGSRAAEYLKEHLFENLMKHPEFMTNTKLAISETYKKTDSEFL 310 The following BLAST results are available for this feature:
BLAST of FC931172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC931172 ID=FC931172; Name=FC931172; organism=Citrus clementina; type=EST; length=705bpback to top |