FC931212
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC931212 vs. ExPASy Swiss-Prot
Match: DHH1_CRYNE (ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans GN=DHH1 PE=3 SV=1) HSP 1 Score: 99.7525 bits (247), Expect = 1.285e-20 Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 2 Query: 2 INFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIY 190 INFDFP+ +E+YLHR+GRSGRFGHLGLA++L+T EDR NLYRIE ELGTEI IP ID +Y Sbjct: 347 INFDFPRTAESYLHRIGRSGRFGHLGLAISLLTLEDRHNLYRIESELGTEIAPIPAVIDPVLY 409
BLAST of FC931212 vs. ExPASy Swiss-Prot
Match: CGH1_CAEEL (ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1) HSP 1 Score: 99.7525 bits (247), Expect = 1.285e-20 Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 2 Query: 2 INFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIY 190 INFDFP+N+ETYLHR+GRSGRFGHLG+A+NLITYEDR L RIEQEL T I+ IP +D +Y Sbjct: 353 INFDFPRNAETYLHRIGRSGRFGHLGVAINLITYEDRHTLRRIEQELRTRIEPIPKTVDPKLY 415
BLAST of FC931212 vs. ExPASy Swiss-Prot
Match: DHH1_PICGU (ATP-dependent RNA helicase DHH1 OS=Pichia guilliermondii GN=DHH1 PE=3 SV=1) HSP 1 Score: 98.5969 bits (244), Expect = 2.863e-20 Identity = 44/63 (69.84%), Postives = 54/63 (85.71%), Query Frame = 2 Query: 2 INFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIY 190 INFDFPK +ETYLHR+GRSGRFGHLGLA+N I ++DR +L+ IE ELGTEIK IP ID+++Y Sbjct: 339 INFDFPKTAETYLHRIGRSGRFGHLGLAINFIHWDDRKSLFNIETELGTEIKPIPSDIDRSLY 401 The following BLAST results are available for this feature:
BLAST of FC931212 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 43
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC931212 ID=FC931212; Name=FC931212; organism=Citrus clementina; type=EST; length=637bpback to top |