FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BORBR (Chaperone protein htpG OS=Bordetella bronchiseptica GN=htpG PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.076e-32
Identity = 79/220 (35.91%), Postives = 122/220 (55.45%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKND 652
            F + LK G  ED+ N+ ++A LLR+ ST  G++    S  DYV RMK+GQ+ IYY+T ++  A  NSP LE  +KKG EVL + D +DE+ +  L+EF+GK LVS  K GL L E   E+EKK +  + E F+ L + ++  L                P C+V G+   + ++ R++KA       +      K  +EINP++ ++  +R  +DA+  D
Sbjct:  388 FGQVLKEGTGEDAANRERIARLLRFASTHDGEQAQTVSFADYVGRMKDGQDKIYYVTADTFTAAANSPHLEIFRKKGIEVLLLSDRVDEWMLSYLREFDGKSLVSVAKGGLDLAELADEEEKKRQSEVAETFKPLVERLQQALAEQVKEVRVTQRLVDSPACVVVGQNELSPHLLRMLKAAGQEAPEV------KPVLEINPDHALIARIRDASDAEFGD 601          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ACIF5 (Chaperone protein htpG OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=htpG PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.076e-32
Identity = 85/215 (39.53%), Postives = 121/215 (56.28%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED +N+ ++A LLR+ ST +  +    SL DY+ RM EGQ+ IYYIT +S  A +NSP LE L+KKG EVL + D +DE+    L EFEGK L S  K  L L   E+E+E+K +E  ++  EGL + IK+ LG               P C+V GE      M++++K QA  + S     S+K  +EINP +P++  +    D
Sbjct:  379 FGRVLKEGPGEDYSNREQIARLLRFASTHTDTDTQNVSLADYLARMAEGQDKIYYITADSFLAAKNSPQLELLRKKGIEVLLLSDRVDEWLTSHLPEFEGKALTSVAKGALDLGAIETEEERKSQEETEKDAEGLVERIKNALGERVETVRVSHRLTSSPACIVLGERDMALYMQQLLK-QAGHEIS-----STKPVLEINPTHPMLARIEGEKD 587          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ACIF2 (Chaperone protein htpG OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) GN=htpG PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.076e-32
Identity = 85/215 (39.53%), Postives = 121/215 (56.28%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED +N+ ++A LLR+ ST +  +    SL DY+ RM EGQ+ IYYIT +S  A +NSP LE L+KKG EVL + D +DE+    L EFEGK L S  K  L L   E+E+E+K +E  ++  EGL + IK+ LG               P C+V GE      M++++K QA  + S     S+K  +EINP +P++  +    D
Sbjct:  379 FGRVLKEGPGEDYSNREQIARLLRFASTHTDTDTQNVSLADYLARMAEGQDKIYYITADSFLAAKNSPQLELLRKKGIEVLLLSDRVDEWLTSHLPEFEGKALTSVAKGALDLGAIETEEERKSQEETEKDAEGLVERIKNALGERVETVRVSHRLTSSPACIVLGERDMALYMQQLLK-QAGHEIS-----STKPVLEINPTHPMLARIEGEKD 587          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_NITOC (Chaperone protein htpG OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=htpG PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.185e-31
Identity = 79/211 (37.44%), Postives = 122/211 (57.82%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            F + +K G+ EDS N+ ++A LLR+ ST   + ++  SL DY++RMKEGQ+ IYYIT +S  A ++SP LE  +KKG EVL + D +DE+ V  L EFEGK L S TK  L L   E E EK+ ++ ++E F+ L + +K+ LG               P CLV  ++  +  +ER++K    +   +      +  +E+NP +PI+  L+
Sbjct:  384 FGQVMKEGVGEDSGNREQIARLLRFASTHHDTAEQTVSLADYLSRMKEGQDKIYYITADSFPAAKSSPHLEVFRKKGIEVLLLSDRVDEWLVASLPEFEGKSLQSVTKGELDLGHLEDEQEKQQQKEVEEDFQNLVERVKNNLGDKVKEVRVTHRLTDSPVCLVVEQHDMSGYLERLLKEAGQQAPHI------QPILELNPAHPIIARLK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_XYLFT (Chaperone protein htpG OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=htpG PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.641e-31
Identity = 81/219 (36.99%), Postives = 118/219 (53.88%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHST--KSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED +N+ K+A LLR+ ST   SGD   +L DY+ RMKEGQ+ +YY+TGES   +++SP+LE  +KKG EVL +VD IDE+ +  L EF+GK  V   +  L L   +SE +KK +E + +  E L   IK  LG               P  L  GE      M ++++A   +         +K   E NP +P++E+L    D D+
Sbjct:  385 NFGQVLKEGPAEDYSNREKVASLLRFASTYDTSGDPSVALTDYIARMKEGQDKLYYLTGESYAQIKDSPYLEVFRKKGIEVLLLVDRIDEWLMNYLHEFDGKSFVDIARGDLDLGNLDSEADKKAQEEIAKTKEALASRIKATLGEDVAEVRVSHRLTDSPAVLAIGEGDLGLQMRQLLEASGQK------VPETKPVFEFNPSHPLIEKLDAEQDMDR 597          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_XYLFA (Chaperone protein htpG OS=Xylella fastidiosa GN=htpG PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.641e-31
Identity = 81/219 (36.99%), Postives = 118/219 (53.88%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHST--KSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED +N+ K+A LLR+ ST   SGD   +L DY+ RMKEGQ+ +YY+TGES   +++SP+LE  +KKG EVL +VD IDE+ +  L EF+GK  V   +  L L   +SE +KK +E + +  E L   IK  LG               P  L  GE      M ++++A   +         +K   E NP +P++E+L    D D+
Sbjct:  386 NFGQVLKEGPAEDYSNREKVASLLRFASTYDTSGDPSVALADYIARMKEGQDKLYYLTGESYAQIKDSPYLEVFRKKGIEVLLLVDRIDEWLMNYLHEFDGKSFVDIARGDLDLGNLDSEADKKAQEEIAKTKEALASRIKATLGEDVAEVRVSHRLTDSPAVLAIGEGDLGLQMRQLLEASGQK------VPETKPVFEFNPSHPLIEKLDAEQDMDR 598          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHESR (Chaperone protein htpG OS=Shewanella sp. (strain MR-7) GN=htpG PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.641e-31
Identity = 86/215 (40.00%), Postives = 118/215 (54.88%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  N+ ++A LLR+ ST +G      SL DY++RMKEGQN IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L E++ K+L S T+  L+L E ED  EK+ +E L E+   L + IK  LG               P C+VTGE   ++ M ++M+A              K T EINP +P++  L    D
Sbjct:  387 FGQVLKEGPAEDFANRERIAGLLRFASTHTGSAAPTVSLDDYLSRMKEGQNKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEYKEKQLHSVTRGELELGELEDAAEKEAQEKLAEESAPLVERIKAALGASVADVKVTSRLTDTPACVVTGEGEMSSQMIKLMQAAG------QPVPEVKPTFEINPAHPLVSRLNDLQD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_NITEU (Chaperone protein htpG OS=Nitrosomonas europaea GN=htpG PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.641e-31
Identity = 81/211 (38.39%), Postives = 118/211 (55.92%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHST--KSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKE--KFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            F + LK GI ED +N+ ++A+LLR+ ST  +  ++  SL DY+ RMK  Q  IYYIT +  KA ++SP LE  +KKG EVL + D IDE+ V  L E+ GK L S  K  L L + EDE++ KE  KE   F+ L   +K+VLG               P CLV   +  + N+ R++K+   +         SK  +EINP +P+++ L+
Sbjct:  389 FGQVLKEGIAEDYSNRERIAKLLRFTSTHDEREEQTVSLDDYIARMKPEQEKIYYITADGLKAAQSSPHLEIFRKKGIEVLLLCDRIDEWLVANLNEYTGKSLQSIAKGNLDLGKLEDEEEKKEHEKEAGDFQELTNKMKEVLGEQVKDVRITYRLTESPACLVADTHDVSGNLGRLLKSAGQK------VPDSKPFLEINPHHPMIQRLK 593          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHESA (Chaperone protein htpG OS=Shewanella sp. (strain ANA-3) GN=htpG PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.449e-31
Identity = 85/215 (39.53%), Postives = 118/215 (54.88%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  N+ ++A LLR+ ST +G      SL DY++RMKEGQN IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L E++ K+L S T+  L+L E ED  EK+ +E L E+   L + IK  LG               P C+VTGE   ++ M ++M+A              K T E+NP +P++  L    D
Sbjct:  387 FGQVLKEGPAEDFANRERIAGLLRFASTHTGSAAPTVSLDDYLSRMKEGQNKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEYKEKQLHSVTRGELELGELEDAAEKEAQEKLAEESAPLIERIKAALGASVADVKVTSRLTDTPACVVTGEGEMSSQMIKLMQAAG------QPVPEVKPTFEVNPAHPLVSRLNDLQD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_LEGPL (Chaperone protein htpG OS=Legionella pneumophila (strain Lens) GN=htpG PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.504e-31
Identity = 85/213 (39.91%), Postives = 117/213 (54.93%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  NK  +A+LLR+ +T SG E    SL++YV+RMKEGQ+ IYYIT  S  A +NSP LE  +KKG EVL + D +DE+ VG + EF GKKL S +K  ++L + E  +++KE  ++  E L K IK VL                P C+V  E      M+RI++A   +         SK   EINPE+ +++ L    D
Sbjct:  378 FGLVLKEGPIEDFANKEAIAKLLRFSTTASGSEKQEVSLEEYVSRMKEGQDKIYYITASSYNAAKNSPHLEIFRKKGIEVLLLSDKVDEWLVGYMNEFTGKKLQSISKGKVELGDDETSEQIKEQ-EKTLEPLIKHIKSVLNERVKDVLLTNRLTDSPACVVADEQDMGLEMQRILQAAGQQ------IPVSKPIFEINPEHALIKRLHDIQD 583          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_BORBR9.076e-3235.91Chaperone protein htpG OS=Bordetella bronchiseptic... [more]
HTPG_ACIF59.076e-3239.53Chaperone protein htpG OS=Acidithiobacillus ferroo... [more]
HTPG_ACIF29.076e-3239.53Chaperone protein htpG OS=Acidithiobacillus ferroo... [more]
HTPG_NITOC1.185e-3137.44Chaperone protein htpG OS=Nitrosococcus oceani (st... [more]
HTPG_XYLFT2.641e-3136.99Chaperone protein htpG OS=Xylella fastidiosa (stra... [more]
HTPG_XYLFA2.641e-3136.99Chaperone protein htpG OS=Xylella fastidiosa GN=ht... [more]
HTPG_SHESR2.641e-3140.00Chaperone protein htpG OS=Shewanella sp. (strain M... [more]
HTPG_NITEU2.641e-3138.39Chaperone protein htpG OS=Nitrosomonas europaea GN... [more]
HTPG_SHESA3.449e-3139.53Chaperone protein htpG OS=Shewanella sp. (strain A... [more]
HTPG_LEGPL4.504e-3139.91Chaperone protein htpG OS=Legionella pneumophila (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top