FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSESM (Chaperone protein htpG OS=Pseudomonas syringae pv. tomato GN=htpG PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.883e-31
Identity = 87/243 (35.80%), Postives = 125/243 (51.44%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSL 718
            +F + LK G  ED  NK K+A LLR+ ST   SG++  SL DY+ R KEGQ+ IYY+TGES   V NSP LE  +KKG EVL + D IDE+ +  L +F+GK  V   +  L L   +SE++KK +E + +  EGL + +K  LG               P  L  GE      M +I++A   +         SK   E NP +P++ +L    DA+++++   D            +G SL
Sbjct:  384 NFGQVLKEGPAEDFANKEKIAGLLRFASTSDDSGEQSVSLADYLARGKEGQDKIYYLTGESYAQVRNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLSDFDGKNFVDVARGDLDLGNLDSEEDKKAQEEIAKDKEGLIERLKAALGESVSEVRVSHRLTDSPAILAIGEQDMGLQMRQILEASGQK------VPDSKPIFEFNPAHPLIGKL----DAEQSEERFGDLSHILFDQAALAAGDSL 616          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSEPF (Chaperone protein htpG OS=Pseudomonas fluorescens (strain Pf0-1) GN=htpG PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.883e-31
Identity = 80/219 (36.53%), Postives = 116/219 (52.97%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKS--GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + +K G  ED  NK K+A LLR+ ST    G+++  L +Y+ R KEGQ+ IYY+TGE+   V+NSP LE  +KKG EVL + D IDE+ +  L EF+GK  V   +  L L   +SE++KK  E + +  EGL + +K  LG               P  L  GE      M +I++A   +         SK   E NP +P++E+L   A  D+
Sbjct:  383 NFGQVMKEGPAEDFANKEKIAGLLRFASTNGTDGEQIVGLAEYLARAKEGQDKIYYLTGETYAQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLSEFDGKTFVDVARGDLDLGNLDSEEDKKAAEEVAKSKEGLVERLKTALGDSVAEVRVSHRLTDSPAILAIGEQDLGLQMRQILEASGQK------VPDSKPIFEFNPSHPLIEKLDNEASEDR 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_MARAV (Chaperone protein htpG OS=Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) GN=htpG PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.883e-31
Identity = 80/210 (38.10%), Postives = 120/210 (57.14%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            F   LK G  ED +N+ K+A LLR+ ST +G+  +  SL DY++RMKEGQN IYYITG++  A ++SP LE  +KKG EVL + D IDE+ +G L E++GK+     +  L L   E+E++KK +E   ++ + L + IK  L                P CLV G++   A M++IM+A   +         SK   EIN ++P+++ L
Sbjct:  380 FGTVLKEGPAEDFSNREKIAGLLRFASTHTGEATQNVSLDDYISRMKEGQNKIYYITGDNFAAAKSSPHLEVFRKKGIEVLILSDRIDEWMMGYLSEYDGKQFQDVARGDLDLGEVETEEDKKHQEEAAKEHKDLLERIKTALEDQVQEVRVTNRLTDSPACLVVGQFDMGAQMKKIMEAAGQK------VPESKPIFEINVDHPLVQRL 583          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSEFS (Chaperone protein htpG OS=Pseudomonas fluorescens (strain SBW25) GN=htpG PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.683e-31
Identity = 86/243 (35.39%), Postives = 126/243 (51.85%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKS--GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSL 718
            +F + +K G  ED  NK K+A LLR+ ST+   G+++ SL +Y+ R KEGQ+ IYY+TGE+   V+NSP LE  +KKG EVL + D IDE+ +  L EF+GK  V   +  L L   +SE+EKK  E + +  EGL + IK  LG               P  L  GE      M +I++A   +         SK   E NP +P++E+L    D +++++   D            +G SL
Sbjct:  385 NFGQVMKEGPAEDFANKEKIAGLLRFASTQGDDGEQVVSLAEYLARAKEGQDKIYYLTGETYAQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLNEFDGKSFVDVARGDLDLGNLDSEEEKKEAEEVAKSKEGLVERIKASLGDAVSEVRVSHRLTDSPAILAIGEQDLGMQMRQILEASGQK------VPDSKPIFEFNPAHPLIEKL----DGEQSEERFGDLSHILFDQAALAAGDSL 617          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_LEGPA (Chaperone protein htpG OS=Legionella pneumophila (strain Paris) GN=htpG PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.683e-31
Identity = 84/213 (39.44%), Postives = 117/213 (54.93%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  NK  +A+LLR+ +T SG E    SL++YV+RMKEGQ+ IYYIT  S  A +NSP LE  +KKG EVL + D +DE+ VG + EF GKKL S +K  ++L + E  +++KE  ++  E L K IK VL                P C+V  E      M+RI++A   +         SK   EINP++ +++ L    D
Sbjct:  378 FGLVLKEGPIEDFANKEAIAKLLRFSTTASGSEKQEVSLEEYVSRMKEGQDKIYYITASSYNAAKNSPHLEIFRKKGIEVLLLSDKVDEWLVGYMNEFAGKKLQSISKGKIELGDDETSEQIKEQ-EKTLEPLIKHIKSVLNDRVKDVLLTNRLTDSPACVVADEQDMGLEMQRILQAAGQQ------VPVSKPIFEINPDHALIKRLHDIQD 583          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BORPA (Chaperone protein htpG OS=Bordetella parapertussis GN=htpG PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.683e-31
Identity = 78/220 (35.45%), Postives = 121/220 (55.00%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKND 652
            F + LK G  ED+ N+ ++A LL + ST  G++    S  DYV RMK+GQ+ IYY+T ++  A  NSP LE  +KKG EVL + D +DE+ +  L+EF+GK LVS  K GL L E   E+EKK +  + E F+ L + ++  L                P C+V G+   + ++ R++KA       +      K  +EINP++ ++  +R  +DA+  D
Sbjct:  388 FGQVLKEGTGEDAANRERIARLLCFASTHDGEQAQTVSFADYVGRMKDGQDKIYYVTADTFTAAANSPHLEIFRKKGIEVLLLSDRVDEWMLSYLREFDGKSLVSVAKGGLDLAELADEEEKKRQSEVAETFKPLVERLQQALAEQVKEVRVTQRLVDSPACVVVGQNELSPHLLRMLKAAGQEAPEV------KPVLEINPDHALIARIRDASDAEFGD 601          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEAM (Chaperone protein htpG OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=htpG PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.003e-30
Identity = 84/215 (39.07%), Postives = 115/215 (53.49%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  N+ ++A LLR+ ST +GD     SL DY+ RMKEGQ  IYYI  +S +A  NSP LE LKKKG EVL + + IDE+ +  L +++ K L S T+  L L   E E EK  +E L ++ E L +  K  LG               P C+VTGE   ++ M ++M+A             SK T+E+NP +P++  L K  D
Sbjct:  387 FGTVLKEGPAEDFANRERIAGLLRFASTHTGDATPSVSLDDYIGRMKEGQEKIYYIVADSHEAAANSPHLELLKKKGIEVLLLSERIDEWLINHLHDYKEKALHSVTRGDLDLGALEDEAEKAAQEKLAQESEPLVERFKSALGDKVSDVKITTRLTDTPACVVTGEGEMSSQMIKLMQAAG------QPVPESKPTLELNPTHPLVARLDKEQD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSEF5 (Chaperone protein htpG OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=htpG PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.003e-30
Identity = 86/243 (35.39%), Postives = 125/243 (51.44%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKS--GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSL 718
            +F + +K G  ED  NK K+A LLR+ ST+   G++  SL DY+ R KEGQ+ IY++TGES   V+NSP LE  +KKG EVL + D IDE+ +  L EF+GK  V   +  L L   +SE++KK  E + +  EGL + IK  LG               P  L  GE      M +I++A   +         SK   E NP +P++E+L    D +++++   D            +G SL
Sbjct:  383 NFGQVMKEGPAEDFANKEKIAGLLRFASTQGDDGEQNVSLADYLARAKEGQDKIYFLTGESYAQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLNEFDGKSFVDVARGDLDLGNLDSEEDKKAAEEVAKTKEGLVERIKTALGESVSEVRVSHRLTDSPAILAIGEQDLGLQMRQILEASGQK------VPDSKPIFEFNPTHPLIEKL----DGEQSEERFGDLSHILFDQAALAAGDSL 615          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSE14 (Chaperone protein htpG OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=htpG PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.003e-30
Identity = 86/243 (35.39%), Postives = 127/243 (52.26%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSL 718
            +F + LK G  ED  NK K+A LLR+ ST   SG++  SL +Y+ R KEGQ+ IYY+TGES   V+NSP LE  +KKG EVL + D IDE+ +  L +F+GK  V   +  L L   +SE++KK +E + +  EGL + +K  LG               P  L  GE      M +I++A   +         SK   E NP +P++ +L    DA+++++   D           ++G SL
Sbjct:  384 NFGQVLKEGPAEDFANKEKIAGLLRFASTSDDSGEQSVSLAEYLARAKEGQDKIYYLTGESYAQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLSDFDGKGFVDVARGDLDLGNLDSEEDKKAQEEIAKDKEGLIERLKAALGESVSEVRVSHRLTDSPAILAIGEQDMGLQMRQILEASGQK------VPDSKPIFEFNPAHPLIGKL----DAEQSEERFGDLSHILFDQAALSAGDSL 616          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_LEGPH (Chaperone protein htpG OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=htpG PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.003e-30
Identity = 84/213 (39.44%), Postives = 117/213 (54.93%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  NK  +A+LLR+ +T SG E    SL++YV+RMKEGQ+ IYYIT  S  A +NSP LE  +KKG EVL + D +DE+ VG + EF GKKL S +K  ++L + E  +++KE  ++  E L K IK VL                P C+V  E      M+RI++A   +         SK   EINP++ +++ L    D
Sbjct:  378 FGLVLKEGPIEDFANKEAIAKLLRFSTTASGSEKQEVSLEEYVSRMKEGQDKIYYITASSYNAAKNSPHLEIFRKKGIEVLLLSDKVDEWLVGYMNEFAGKKLQSISKGKVELGDDETSEQIKEQ-EKTLEPLIKHIKSVLNERVKDVLLTNRLTDSPACVVADEQDMGLEMQRILQAAGQQ------VPVSKPIFEINPDHALIKRLHDIQD 583          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_PSESM5.883e-3135.80Chaperone protein htpG OS=Pseudomonas syringae pv.... [more]
HTPG_PSEPF5.883e-3136.53Chaperone protein htpG OS=Pseudomonas fluorescens ... [more]
HTPG_MARAV5.883e-3138.10Chaperone protein htpG OS=Marinobacter aquaeolei (... [more]
HTPG_PSEFS7.683e-3135.39Chaperone protein htpG OS=Pseudomonas fluorescens ... [more]
HTPG_LEGPA7.683e-3139.44Chaperone protein htpG OS=Legionella pneumophila (... [more]
HTPG_BORPA7.683e-3135.45Chaperone protein htpG OS=Bordetella parapertussis... [more]
HTPG_SHEAM1.003e-3039.07Chaperone protein htpG OS=Shewanella amazonensis (... [more]
HTPG_PSEF51.003e-3035.39Chaperone protein htpG OS=Pseudomonas fluorescens ... [more]
HTPG_PSE141.003e-3035.39Chaperone protein htpG OS=Pseudomonas syringae pv.... [more]
HTPG_LEGPH1.003e-3039.44Chaperone protein htpG OS=Legionella pneumophila s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top