FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_VIBC3 (Chaperone protein htpG OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.504e-30
Identity = 82/216 (37.96%), Postives = 116/216 (53.70%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE---KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   +K G  ED  N+ K+A LLR+ ST   S ++  SL  YV RMKEGQ+ IYY+T +S  A +NSP LE+ K KG EV+ M D IDE+ +  L EFEGK   S TK GL L + EDE   +K KET +E+F+ + + +K  LG               P  +VT +Y     M +++ A              K  +E+NPE+ +++ +   AD
Sbjct:  386 FGLVMKEGPAEDFANREKIASLLRFASTHIDSAEQTISLASYVERMKEGQDKIYYLTADSYTAAKNSPHLEQFKSKGIEVILMFDRIDEWLMNYLPEFEGKAFQSITKAGLDLSQFEDEAEKEKHKET-EEQFKSVVERLKGYLGSRVKEVRTTFKLANTPAVVVTDDYEMGTQMAKLLAAAG------QPVPEVKYILEVNPEHALVKRMADEAD 594          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEB5 (Chaperone protein htpG OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.504e-30
Identity = 82/215 (38.14%), Postives = 116/215 (53.95%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  N+ ++A LLR+ ST +G      SL DY++RMKEGQ  IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L E++ K+L S T+  L+L E ED  EK+ +E L+++   L + IK  LG               P C+V G+   +  M ++M+A              K T EINP +P++  L    D
Sbjct:  387 FGQVLKEGPAEDFANRERIAGLLRFASTHTGSAAPTVSLDDYISRMKEGQTKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEYKEKQLHSVTRGDLELGELEDAAEKEAQEKLEQESVALVERIKAALGSSVADVKVTSRLTDTPACVVAGDGEMSTQMIKLMQAAG------QPVPEVKPTFEINPAHPLVSRLNDLQD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_COXBU (Chaperone protein htpG OS=Coxiella burnetii GN=htpG PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.504e-30
Identity = 81/218 (37.16%), Postives = 125/218 (57.34%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSG--DELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMK-ETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  N+ ++A LLR+ ST +   ++  SL+DY++RMK  QN IYYI  ++  + +NSP LE  +KK  EVL M D +DE+ V  L EFEGK L S  K  L L + E E+K++ E  ++ F+ L K  K+VLG               P C+V  E   + +++R++  Q  +D     +M +K  +EINP +P++  LR + ++DK
Sbjct:  385 AFGQVLKEGPAEDFANRDRIANLLRFASTHNDTDEQNVSLQDYISRMKPEQNKIYYIVADTYTSAKNSPLLEVFRKKDIEVLLMSDRVDEWLVAHLNEFEGKSLQSIAKGTLDLGDLEKEEKVETEKFEKDFDELLKQFKEVLGEKIKDVRITHRLTDSPTCVVFDENEMSGHLQRLL-IQTGQD-----FMQAKPILEINPSHPLI--LRVKNESDK 594          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_COXBR (Chaperone protein htpG OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.504e-30
Identity = 81/218 (37.16%), Postives = 125/218 (57.34%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSG--DELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMK-ETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  N+ ++A LLR+ ST +   ++  SL+DY++RMK  QN IYYI  ++  + +NSP LE  +KK  EVL M D +DE+ V  L EFEGK L S  K  L L + E E+K++ E  ++ F+ L K  K+VLG               P C+V  E   + +++R++  Q  +D     +M +K  +EINP +P++  LR + ++DK
Sbjct:  385 AFGQVLKEGPAEDFANRDRIANLLRFASTHNDTDEQNVSLQDYISRMKPEQNKIYYIVADTYTSAKNSPLLEVFRKKDIEVLLMSDRVDEWLVAHLNEFEGKSLQSIAKGTLDLGDLEKEEKVETEKFEKDFDELLKQFKEVLGEKIKDVRITHRLTDSPTCVVFDENEMSGHLQRLL-IQTGQD-----FMQAKPILEINPSHPLI--LRVKNESDK 594          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_AERS4 (Chaperone protein htpG OS=Aeromonas salmonicida (strain A449) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.504e-30
Identity = 80/210 (38.10%), Postives = 117/210 (55.71%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE--KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            F   LK G  ED  N+ ++A+LLR+ ST    E    SL+DYV RMKEGQ  IYYIT +S  A +NSP LE  +KKG EVL M + +DE+ +  L EF+GK+LVS T+  L L + EDE  K+ +E  ++   GL + +K  LG               P C+VT  +G +  M ++M+A              K  +E+NP++ ++++L
Sbjct:  389 FGNVLKEGPAEDYANREEIAKLLRFASTAGEGEAQTVSLEDYVGRMKEGQQKIYYITADSFAAAKNSPHLEIFRKKGVEVLLMWERVDEWLMSHLTEFDGKQLVSVTRGELDLGDLEDEASKQAQEEAEKANAGLVERVKTSLGEAVKEVRVTHRLTDSPSCIVTDNHGMSTQMIKLMRAAG------QPVPEQKYILELNPDHALVKKL 592          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSEA6 (Chaperone protein htpG OS=Pseudoalteromonas atlantica (strain T6c / BAA-1087) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.495e-30
Identity = 81/218 (37.16%), Postives = 117/218 (53.67%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  NK K+A LLR+ ST++  +    SL DYV+RMK+GQ+ IYYIT +S KA ++SP LE  +KKG EVL M D +DE+ +  L EF+ K   S T   L L   + ED KK +E  +++ EGL + +K VLG               P C+V    G +  M ++M+A             +K   E+NPE+ +++ L    D ++
Sbjct:  390 FGNVLKEGPAEDHANKEKVAGLLRFASTENDSDAQNVSLADYVSRMKDGQDKIYYITADSYKAAKSSPHLEIFRKKGIEVLLMSDRVDEWLMSHLTEFDEKSFQSITHGELDLGDLDDEDSKKAQEEAEKQVEGLTERVKTVLGDKVAEVKFTHRLTDSPACIVADGTGMSTQMIKLMQAAG------QPVPEAKYHFELNPEHSLVKMLADEQDEER 601          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_NOCFA (Chaperone protein htpG OS=Nocardia farcinica GN=htpG PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.495e-30
Identity = 82/220 (37.27%), Postives = 117/220 (53.18%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKE----KFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKND 652
            F + LK G+  D  N+  + ++  + ST S  ELT+L  YV RM EGQ+ IYY+TGES++ VE+SP +E  K KG EVL + D +DE  VG + EF+GK+  S  K  + L ESE+EKK  E L+E    +F  L   +   L                P CLV   + +T  +ER+ +A      S      SK+ +E+NP +P++  LR   D  K D
Sbjct:  394 FGRVLKEGLLSDFDNRETILQVSSFASTHSDSELTTLAQYVERMPEGQDAIYYMTGESRQQVESSPHMEAFKAKGREVLILTDPVDEMWVGSVPEFDGKRFQSIAKGEVDL-ESEEEKKASEALREQQDKEFADLLSWLGKTLEENIKEVRLTNRLTTSPACLVGDVFDFTPMLERMYRA------SGQPVPVSKRILELNPTHPLVTGLRDAYDQRKQD 606          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_NITEC (Chaperone protein htpG OS=Nitrosomonas eutropha (strain C91) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.495e-30
Identity = 78/211 (36.97%), Postives = 116/211 (54.98%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHST--KSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKE--KFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            F + LK G+ ED +N+ ++A+LLR+ ST  +  ++  SL DY+ RMK  Q  IYYIT +  KA ++SP LE  +KKG EVL + D IDE+    L E+ GK L S  K  L L + EDE + +E  KE   F+ L   +K+VLG               P CLV   +  + N+ R++K+   +         SK  +EINP +P+++ L+
Sbjct:  389 FGQVLKEGVAEDYSNRERIAKLLRFTSTHDEQEEQTVSLDDYIARMKPEQEKIYYITADGLKAAQSSPHLEIFRKKGIEVLLLHDRIDEWLTANLNEYAGKSLQSIAKGDLDLGKLEDEVEKQEHEKEAGDFQELTAKMKEVLGELVKDVRITYRLTESPACLVADTHDMSGNLGRLLKSAGQK------VPDSKPFLEINPHHPMVQRLK 593          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_COXBN (Chaperone protein htpG OS=Coxiella burnetii (strain Dugway 5J108-111) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.495e-30
Identity = 81/218 (37.16%), Postives = 125/218 (57.34%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSG--DELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMK-ETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  N+ ++A LLR+ ST +   ++  SL+DY++RMK  QN IYYI  ++  + +NSP LE  +KK  EVL M D +DE+ V  L EFEGK L S  K  L L + E E+K++ E  ++ F+ L K  K+VLG               P C+V  E   + +++R++  Q  +D     +M +K  +EINP +P++  LR + ++DK
Sbjct:  385 AFGQVLKEGPAEDFANRDRIANLLRFASTHNDTDEQNVSLQDYISRMKPEQNRIYYIVADTYTSAKNSPLLEVFRKKDIEVLLMSDRVDEWLVAHLNEFEGKSLQSIAKGTLDLGDLEKEEKVETEKFEKDFDELLKQFKEVLGEKIKDVRITHRLTDSPTCVVFDENEMSGHLQRLL-IQTGQD-----FMQAKPILEINPSHPLI--LRVKNESDK 594          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_VIBSL (Chaperone protein htpG OS=Vibrio splendidus (strain LGP32) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.109e-29
Identity = 78/215 (36.28%), Postives = 117/215 (54.42%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  NK K+A LLR+ ST+  S ++   L  YV RMKEGQ+ IYY+T +S  A +NSP LE+ K KG EV+ M D IDEY +  L +F+GK+  S TK GL L   E E+EK+ ++  +E+F+ + +  +  LG               P  +VT ++     M ++++A       +      K   EINPE+ +++++   AD
Sbjct:  386 FGLVLKEGPAEDMANKEKIAGLLRFSSTEVDSSEQTIGLASYVERMKEGQDKIYYLTADSYAAAKNSPHLEQFKAKGIEVVLMYDRIDEYVMNYLTDFDGKQFQSITKAGLDLSKFEGEEEKEKQKETEEEFKSVVERTQSYLGGRVKEVRTTFKLATTPAVVVTDDFEMGTQMAKLLEAAGQAAPEV------KYIFEINPEHALVKQMADEAD 594          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_VIBC36.504e-3037.96Chaperone protein htpG OS=Vibrio cholerae serotype... [more]
HTPG_SHEB56.504e-3038.14Chaperone protein htpG OS=Shewanella baltica (stra... [more]
HTPG_COXBU6.504e-3037.16Chaperone protein htpG OS=Coxiella burnetii GN=htp... [more]
HTPG_COXBR6.504e-3037.16Chaperone protein htpG OS=Coxiella burnetii (strai... [more]
HTPG_AERS46.504e-3038.10Chaperone protein htpG OS=Aeromonas salmonicida (s... [more]
HTPG_PSEA68.495e-3037.16Chaperone protein htpG OS=Pseudoalteromonas atlant... [more]
HTPG_NOCFA8.495e-3037.27Chaperone protein htpG OS=Nocardia farcinica GN=ht... [more]
HTPG_NITEC8.495e-3036.97Chaperone protein htpG OS=Nitrosomonas eutropha (s... [more]
HTPG_COXBN8.495e-3037.16Chaperone protein htpG OS=Coxiella burnetii (strai... [more]
HTPG_VIBSL1.109e-2936.28Chaperone protein htpG OS=Vibrio splendidus (strai... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top