FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_VIBHB (Chaperone protein htpG OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=htpG PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.506e-29
Identity = 78/218 (35.78%), Postives = 118/218 (54.13%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE---KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F   +K G+ ED  NK K+A LLR+ ST+  S ++   L  YV RMKEGQ+ IY++T +S  A +NSP LE+ + KG EV+ M D IDE+ +  L EF+GK+  S TK GL L + EDE   +K KET +E+F+ + +  +  LG               P  +VT ++     M ++++A              K   EINPE+ +++ +   AD +
Sbjct:  386 FGLVMKEGVAEDMANKEKVAGLLRFASTEVDSAEQTVGLASYVERMKEGQDKIYFLTADSYAAAKNSPHLEQFRAKGIEVILMFDRIDEWLMNYLTEFDGKQFQSITKAGLDLSKFEDEAEKEKQKET-EEEFKSVVERTQSYLGDRVKEVRTTFKLATTPAVVVTDDFEMGTQMAKLLEAAG------QAVPEVKYIFEINPEHALVKRMADEADEE 596          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ALISL (Chaperone protein htpG OS=Aliivibrio salmonicida (strain LFI1238) GN=htpG PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.506e-29
Identity = 78/217 (35.94%), Postives = 118/217 (54.38%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F + LK G+ ED  NK K+A LLR+ ST   S ++  SL  YV RMKE Q+ I+Y+T +S  A +NSP LE+ K KG EV+ M D IDE+ +  L EF+GK+  S TK GL L   E+E EK+ ++   E+F+ + +  K  LG               P  +VT ++     M ++++A       +      K   EINPE+ +++++   AD +
Sbjct:  385 FGQVLKEGLAEDFANKDKIAGLLRFASTNKDSSEQAISLASYVERMKEDQDKIFYLTSDSYAAAKNSPHLEQFKSKGIEVVLMYDRIDEWLMSYLTEFDGKQFQSITKAGLDLSKFENEAEKEKQKETTEEFKSVVERTKAYLGDRVKEVRTTFKLATTPAVVVTDDFEMGTQMAKLLEAAGQAAPEV------KYIFEINPEHALIKQMADEADEE 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ACIAD (Chaperone protein htpG OS=Acinetobacter sp. (strain ADP1) GN=htpG PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.506e-29
Identity = 78/217 (35.94%), Postives = 118/217 (54.38%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMK--AQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F   LK G+ ED TN+ ++ +LLRY ++   +  TS  DY  RMKEGQ  IYY++ +S  A +NSP LE  KKKG EVL M + +DE+A+  + EF+G  L + +K  + L + +D  EKK  E   E+F+ +   + D L                P CLVT +   +  + R++K   QA+ +        SK  +EINPE+P++++L   A  D
Sbjct:  398 FGSVLKEGLGEDFTNRERILKLLRYATSNQDEISTSFADYKARMKEGQKAIYYVSADSLAAAKNSPQLELFKKKGIEVLLMSERVDEWAMNFVHEFDGTPLQNVSKGAVDLGDLQDAEEKKALEQAAEQFKPVVDKLTDALKDKTKEVRVTTRLVDSPACLVTSDGELSPQLIRMLKQAGQAVPE--------SKPILEINPEHPLVQKLEGSAQFD 606          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_VIBVU (Chaperone protein htpG OS=Vibrio vulnificus GN=htpG PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.191e-29
Identity = 78/218 (35.78%), Postives = 117/218 (53.67%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE---KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F   +K G  ED  N+ K+A LLR+ ST+  S ++  SL+ YV RMKEGQ+ IYY+T +S  A +NSP LE+ K KG EV+ M D IDE+ +  L EF+GK+  S TK GL L + EDE   +K KET +++F+ + +  K  LG               P  +VT ++     M +++ A              K   EINP + +++++    D +
Sbjct:  386 FGLVMKEGPAEDYANREKVASLLRFASTEVDSAEQTVSLESYVERMKEGQDKIYYLTADSYAAAKNSPHLEQFKAKGLEVILMFDRIDEWLMNYLTEFDGKQFQSITKAGLDLSQFEDEQEKEKQKET-EQEFQSVVERTKSYLGDRVKEVRTTFKLANTPAVVVTDDFEMGTQMAKLLAAAG------QAVPEVKYIFEINPNHTLVKQMADETDEE 596          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BURS3 (Chaperone protein htpG OS=Burkholderia sp. (strain 383) GN=htpG PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.191e-29
Identity = 77/220 (35.00%), Postives = 124/220 (56.36%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE-SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKND 652
            +F + LK G+ ED  N+ ++A+LLR+ ST    +    SL DYV+RMK  Q+ IYY+T ++ +A +NSP LE  +KKG EVL + D +DE+ +  L+EF+GK L S  +  L L E +++EKK +E   E  + + + +K+ LG               P CLV  +   +  ++R++KA      +M      +  +EINPE+ ++++L K   AD  D
Sbjct:  384 AFGQVLKEGLGEDHANRERIAKLLRFASTHGDTDAQDVSLADYVSRMKPEQSRIYYVTADAWQAAKNSPHLEVFRKKGVEVLLLTDRVDEWMLSFLQEFDGKPLASVARGDLDLGELNDEEKKAQEEAGEAIKPVVEKMKEALGDKVKEVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAGQNAPAM------QPILEINPEHALVKQL-KADSADFGD 596          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_MAGSM (Chaperone protein htpG OS=Magnetococcus sp. (strain MC-1) GN=htpG PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 9.392e-29
Identity = 81/226 (35.84%), Postives = 119/226 (52.65%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELT--SLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD----------ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G+ ED  NK ++A+L R+ +T  G+ +   +L DYV RMKEGQ  IYY+TGES +A  +SP LE  +KKG EVL + D +DE+ V  L EF+GK L + TK  L L           + E EK  +E LK   E + KV++  +                P CLV   +  +A +ER++K             ++K+ +EINP + +++ L   AD +K
Sbjct:  391 FGMVLKEGMIEDFANKERIAKLCRFSTTHDGERVPKIALADYVERMKEGQEAIYYVTGESFEACSSSPHLEIFRKKGIEVLLLSDRVDEWTVTHLTEFDGKPLQAITKGELDLSKFAGGEEEAKDEEAEKAQEEALKPITERMAKVLEGQV----KEVRLSHRLTESPACLVGDAHDMSATLERLLKEAGQE------VPTAKRILEINPSHALLKRLADEADEEK 606          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSYIN (Chaperone protein htpG OS=Psychromonas ingrahamii (strain 37) GN=htpG PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.227e-28
Identity = 78/217 (35.94%), Postives = 116/217 (53.46%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F + LK G  EDS+NK K+ +L R+ ST+  S ++  SL  Y++RM EGQ+ IYYIT +S  A +NSP LE L++KG EVL + D IDE+ +  L E++GK   S T+  L L   +SE++KK +E  + +F    + +K VLG               P C+V      +  M ++M               SK   E+NPE+ ++ +L   AD D
Sbjct:  387 FGQVLKEGPAEDSSNKEKIGKLFRFSSTETDSTEQTVSLDAYISRMTEGQDKIYYITADSFNAAKNSPHLEVLREKGIEVLLLSDRIDEWLLSHLPEYDGKTFTSVTQGDLDLGKLDSEEKKKEQEKQETEFASFVERVKAVLGDKVKDVRLTHRLTSTPSCIVADNDDMSTQMAKLMAQMG------QPVPESKPVFELNPEHVMIVKLADMADED 597          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SALTO (Chaperone protein htpG OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=htpG PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.092e-28
Identity = 74/225 (32.89%), Postives = 118/225 (52.44%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEK----FEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F   +K G+ +D+ N+  L E+L   ST    E T L DYVTRMK+GQ DIYY TGE++  +ENSP +E  + KG+EVL + D +DE  V ++ E+EGK L S  K  + LD +E+E+   E  +E+    +  L   +   L                P C+V   +  T  +E++ +A       +      K+ +E+NP +P++  LRK  +    ++S+K+
Sbjct:  384 FGAVVKEGLIDDTENRDSLLEILSVASTHDPAEPTDLADYVTRMKDGQTDIYYATGENRSTIENSPHMEAFRAKGFEVLLLTDPVDEVWVERVGEYEGKTLRSVAKGQVDLD-TEEERSAAEAERERQRTEYADLLTWLSSTLADQVREVRLSARLTTSPACVVGDAHDVTPTLEKMYRAMGHEVPQV------KRILELNPTHPLVSGLRKAREQGVTEESLKE 601          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PHOPR (Chaperone protein htpG OS=Photobacterium profundum GN=htpG PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.092e-28
Identity = 78/217 (35.94%), Postives = 120/217 (55.30%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKS--GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F + LK G  ED +N+ K+A LLR+ ST +   D+  S+ DYV+RMKEGQ  IY++T +S  A +NSP LE+ + KG EV+ M D IDE+ + QL EF+GK   + TK  L L   E+E++K+ ++   E+F+ + +  K  LG               P  +VT E      M +++ A A  D     Y+      EINPE+ +++++   AD +
Sbjct:  386 FGQVLKEGPAEDFSNREKIANLLRFSSTHNDTADQTVSVADYVSRMKEGQEKIYFLTADSFTAAKNSPHLEQFRAKGLEVILMHDRIDEWLMSQLPEFDGKPFQAITKADLDLSKFENEEDKEKQKEAAEEFKSVVERAKGYLGTRVKDVRTTFKLHDTPAVVVTDENEMGTQMAKLL-AAAGHDAPEVQYI-----FEINPEHGLVKQMANEADEE 596          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BURCM (Chaperone protein htpG OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=htpG PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.092e-28
Identity = 73/210 (34.76%), Postives = 119/210 (56.67%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE-SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            +F + LK G+ ED  N+ ++A+LLR+ ST    +    SL DYV+RMK  Q+ IYY+T ++ +A +NSP LE  +KKG EVL + D +DE+ +  L EF+GK L S  +  L L E +++EKK +E   E  + + + +K+ LG               P CLV  +   +  ++R++KA      +M      +  +EINPE+ ++++L
Sbjct:  384 AFGQVLKEGLGEDHANRERIAKLLRFASTHGDTDAQDVSLADYVSRMKPEQSKIYYVTADTWQAAKNSPHLEVFRKKGVEVLLLTDRVDEWMLSFLHEFDGKPLASVARGDLDLGELNDEEKKAQEQAGEAIKPVVEKMKEALGDKVKEVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAGQNAPAM------QPILEINPEHALVKQL 587          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_VIBHB5.506e-2935.78Chaperone protein htpG OS=Vibrio harveyi (strain A... [more]
HTPG_ALISL5.506e-2935.94Chaperone protein htpG OS=Aliivibrio salmonicida (... [more]
HTPG_ACIAD5.506e-2935.94Chaperone protein htpG OS=Acinetobacter sp. (strai... [more]
HTPG_VIBVU7.191e-2935.78Chaperone protein htpG OS=Vibrio vulnificus GN=htp... [more]
HTPG_BURS37.191e-2935.00Chaperone protein htpG OS=Burkholderia sp. (strain... [more]
HTPG_MAGSM9.392e-2935.84Chaperone protein htpG OS=Magnetococcus sp. (strai... [more]
HTPG_PSYIN1.227e-2835.94Chaperone protein htpG OS=Psychromonas ingrahamii ... [more]
HTPG_SALTO2.092e-2832.89Chaperone protein htpG OS=Salinispora tropica (str... [more]
HTPG_PHOPR2.092e-2835.94Chaperone protein htpG OS=Photobacterium profundum... [more]
HTPG_BURCM2.092e-2834.76Chaperone protein htpG OS=Burkholderia ambifaria (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top