FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_PIG (Heat shock protein HSP 90-alpha OS=Sus scrofa GN=HSP90AA1 PE=2 SV=3)

HSP 1 Score: 294.664 bits (753), Expect = 3.401e-79
Identity = 146/239 (61.09%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  IYYITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERIMKAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  442 FSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 680          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_PANTR (Heat shock protein HSP 90-alpha OS=Pan troglodytes GN=HSP90AA1 PE=2 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 3.401e-79
Identity = 146/239 (61.09%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  IYYITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERIMKAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  442 FSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 680          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_MACFA (Heat shock protein HSP 90-alpha OS=Macaca fascicularis GN=HSP90AA1 PE=2 SV=3)

HSP 1 Score: 294.664 bits (753), Expect = 3.401e-79
Identity = 146/239 (61.09%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  IYYITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERIMKAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  442 FSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 680          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_HUMAN (Heat shock protein HSP 90-alpha OS=Homo sapiens GN=HSP90AA1 PE=1 SV=5)

HSP 1 Score: 294.664 bits (753), Expect = 3.401e-79
Identity = 146/239 (61.09%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  IYYITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERIMKAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  441 FSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 679          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_BOVIN (Heat shock protein HSP 90-alpha OS=Bos taurus GN=HSP90AA1 PE=2 SV=3)

HSP 1 Score: 294.664 bits (753), Expect = 3.401e-79
Identity = 146/239 (61.09%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  IYYITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERIMKAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  442 FSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 680          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_CHICK (Heat shock protein HSP 90-alpha OS=Gallus gallus GN=HSP90AA1 PE=3 SV=3)

HSP 1 Score: 294.278 bits (752), Expect = 4.442e-79
Identity = 145/239 (60.67%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  +YYITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERIMKAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  437 FSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHVYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKAKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 675          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSC90_DICDI (Heat shock cognate 90 kDa protein OS=Dictyostelium discoideum GN=hspD PE=1 SV=2)

HSP 1 Score: 293.508 bits (750), Expect = 7.577e-79
Identity = 154/240 (64.17%), Postives = 182/240 (75.83%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLG+HEDS N+ K A+LLRY ++KSGDEL +LK+YV RMKEGQN+IYYITGESKKAVENSPF+E LKKK  EV+YM D IDEYAV QLKE++GKKLVS TKEGLKLDE+EDEKK  E  K   E L K +KDVLG               PC LVT EYGW+ANMERIMKAQALRD+SM+ YMSSKKT+E+NP++PI+ +L K+A A+K+ K+ KD           TSG SLD
Sbjct:  408 AFSKNLKLGVHEDSQNREKFADLLRYQTSKSGDELVTLKEYVGRMKEGQNEIYYITGESKKAVENSPFIEGLKKKNLEVIYMCDPIDEYAVQQLKEYDGKKLVSITKEGLKLDETEDEKKKAEQDKAANEELLKQVKDVLGDKVEKVVLSTRLANSPCVLVTSEYGWSANMERIMKAQALRDSSMSSYMSSKKTLELNPDHPIVRDLAKKA-AEKS-KTFKDFVYLLYETALLTSGFSLD 645          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_RAT (Heat shock protein HSP 90-alpha OS=Rattus norvegicus GN=Hsp90aa1 PE=1 SV=3)

HSP 1 Score: 293.123 bits (749), Expect = 9.896e-79
Identity = 145/239 (60.67%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  IY+ITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERIMKAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  442 FSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 680          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_MOUSE (Heat shock protein HSP 90-alpha OS=Mus musculus GN=Hsp90aa1 PE=1 SV=4)

HSP 1 Score: 293.123 bits (749), Expect = 9.896e-79
Identity = 145/239 (60.67%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  IY+ITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERIMKAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  442 FSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 680          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_HORSE (Heat shock protein HSP 90-alpha (Fragment) OS=Equus caballus GN=HSP90AA1 PE=2 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.688e-78
Identity = 145/238 (60.92%), Postives = 177/238 (74.37%), Query Frame = 2
Query:    8 SKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            SKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  IYYITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERIMKAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  432 SKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 669          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HS90A_PIG3.401e-7961.09Heat shock protein HSP 90-alpha OS=Sus scrofa GN=H... [more]
HS90A_PANTR3.401e-7961.09Heat shock protein HSP 90-alpha OS=Pan troglodytes... [more]
HS90A_MACFA3.401e-7961.09Heat shock protein HSP 90-alpha OS=Macaca fascicul... [more]
HS90A_HUMAN3.401e-7961.09Heat shock protein HSP 90-alpha OS=Homo sapiens GN... [more]
HS90A_BOVIN3.401e-7961.09Heat shock protein HSP 90-alpha OS=Bos taurus GN=H... [more]
HS90A_CHICK4.442e-7960.67Heat shock protein HSP 90-alpha OS=Gallus gallus G... [more]
HSC90_DICDI7.577e-7964.17Heat shock cognate 90 kDa protein OS=Dictyostelium... [more]
HS90A_RAT9.896e-7960.67Heat shock protein HSP 90-alpha OS=Rattus norvegic... [more]
HS90A_MOUSE9.896e-7960.67Heat shock protein HSP 90-alpha OS=Mus musculus GN... [more]
HS90A_HORSE1.688e-7860.92Heat shock protein HSP 90-alpha (Fragment) OS=Equu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top