FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS90A_CRIGR (Heat shock protein HSP 90-alpha OS=Cricetulus griseus GN=HSP90AA1 PE=2 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 2.879e-78
Identity = 144/239 (60.25%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL+ELLRY+++ SGDE+ SLKDY TRMKE Q  IY+ITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKEFEGK LVS TKEGL+L E E+EKK +E  K KFE LCK++KD+L                PCC+VT  YGWTANMERI+KAQALRDNS  GYM++KK +EINP++ I+E LR++A+ADKNDKSVKD           +SG SL+
Sbjct:  442 FSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIIKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLE 680          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_EIMTE (Heat shock protein 90 OS=Eimeria tenella GN=HSP90 PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 3.760e-78
Identity = 149/239 (62.34%), Postives = 176/239 (73.64%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKNLKLGIHEDS N+ K+AELLR+HS+KSG+++ S K+YV RMKEGQ DIYYITGES++ V NSPFLEKL KKGYEVLYM D IDEYAV QLKEF+  KL   TKEGL++DESE+EKK  E LK +FE L K+IK+VL                PC LVT E+GW+ANMERIMKAQALRDNSM  YM SKKTME+N  + IM E++ +A  DK+DK+VKD           TSG SL+
Sbjct:  425 FSKNLKLGIHEDSANRAKIAELLRFHSSKSGEDMVSFKEYVDRMKEGQKDIYYITGESRQTVANSPFLEKLTKKGYEVLYMTDPIDEYAVQQLKEFDNHKLRCCTKEGLEIDESEEEKKKFEELKAEFEPLLKLIKEVLHDKVDKVVLSNRITDSPCVLVTTEFGWSANMERIMKAQALRDNSMTSYMVSKKTMEVNGHHSIMIEIKNKAAVDKSDKTVKDLIWLLYDTALLTSGFSLE 663          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: H90A1_DANRE (Heat shock protein HSP 90-alpha 1 OS=Danio rerio GN=hsp90a.1 PE=2 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 6.414e-78
Identity = 140/239 (58.58%), Postives = 180/239 (75.31%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDS N+ KL++LLRY+++ SGDE+ SLKDYV+RMK+ Q  IYYITGE+K  V NS F+E+L+K G EV+YM++ IDEY V QLKE++GK LVS TKEGL+L E E+EKK ++ LK K+E LCK++KD+L                PCC+VT  YGWTANMERIMK+QALRDNS  GYM++KK +EINP +PI+E LR++A+ADKNDK+VKD           +SG +LD
Sbjct:  434 FSKNIKLGIHEDSQNRKKLSDLLRYYTSASGDEMVSLKDYVSRMKDTQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKEYDGKNLVSVTKEGLELPEDEEEKKKQDELKAKYENLCKIMKDILDKKIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPAHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLD 672          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_BRUPA (Heat shock protein 90 OS=Brugia pahangi GN=HSP90 PE=2 SV=2)

HSP 1 Score: 288.5 bits (737), Expect = 2.437e-77
Identity = 140/239 (58.58%), Postives = 183/239 (76.57%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDSTN+ KL+E LR++++ S +E+TSLKDYV+RMKE Q  IY+ITGES++AV +S F+E++K++G+EV+YM D IDEY V QLKE++GKKLVS TKEGL+L ESE+EKK  E  K KFE LCKV+KD+L                PCC+VT EYGW+ANMERIMKAQALRD+S  GYM++KK +EINP++ +++ LR+R +ADKNDK+VKD           +SG SL+
Sbjct:  423 FSKNIKLGIHEDSTNRKKLSEFLRFYTSASSEEMTSLKDYVSRMKENQKQIYFITGESREAVASSAFVERVKRRGFEVIYMTDPIDEYCVQQLKEYDGKKLVSVTKEGLELPESEEEKKKFEEDKVKFENLCKVMKDILEKKVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLE 661          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_THEAN (Heat shock protein 90 OS=Theileria annulata GN=TA12105 PE=3 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.183e-77
Identity = 149/239 (62.34%), Postives = 174/239 (72.80%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKNLKLGIHED+ N++K+AELLR+ +TKSGDEL SLK+YV RMK  Q  +YYITGESK++V +SPFLE LK + YEVLYM D IDEYAV Q+KEFEGKKL   TKEGL+LDE EDEKK  E LKE+ E LCK IK+VL                PC LVT E+GW+ANMERIMKAQALRD+S+  YM SKK MEINP + IM+EL+ RA  DK DK+VKD           TSG +LD
Sbjct:  437 FSKNLKLGIHEDNANRSKIAELLRFETTKSGDELVSLKEYVDRMKSDQKFVYYITGESKQSVASSPFLETLKARDYEVLYMTDPIDEYAVQQIKEFEGKKLKCCTKEGLELDEGEDEKKSFEALKEEMEPLCKHIKEVLHDKVEKVVCGTRFTDSPCALVTSEFGWSANMERIMKAQALRDSSITSYMLSKKIMEINPRHSIMKELKARAANDKTDKTVKDLVWLLYDTALLTSGFNLD 675          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_THEPA (Heat shock protein 90 OS=Theileria parva GN=TP02_0244 PE=2 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 1.210e-76
Identity = 148/239 (61.92%), Postives = 173/239 (72.38%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKNLKLGIHED+ N++K+AELLR+ +TKSGDEL SLK+YV RMK  Q  +YYITGESK++V +SPFLE L+ + YEVLYM D IDEYAV Q+KEFEGKKL   TKEGL LDE EDEKK  E LKE+ E LCK IK+VL                PC LVT E+GW+ANMERIMKAQALRD+S+  YM SKK MEINP + IM+EL+ RA  DK DK+VKD           TSG +LD
Sbjct:  436 FSKNLKLGIHEDNANRSKIAELLRFETTKSGDELVSLKEYVDRMKSDQKYVYYITGESKQSVASSPFLETLRARDYEVLYMTDPIDEYAVQQIKEFEGKKLKCCTKEGLDLDEGEDEKKSFEALKEEMEPLCKHIKEVLHDKVEKVVCGTRFTDSPCALVTSEFGWSANMERIMKAQALRDSSITSYMLSKKIMEINPRHSIMKELKTRAANDKTDKTVKDLVWLLYDTALLTSGFNLD 674          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_DROPS (Heat shock protein 83 OS=Drosophila pseudoobscura pseudoobscura GN=Hsp83 PE=3 SV=2)

HSP 1 Score: 282.722 bits (722), Expect = 1.337e-75
Identity = 135/239 (56.49%), Postives = 175/239 (73.22%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKNLKLG+HEDS N+ KLA+ LR+H++ SGD+  SL DYV+RMKE Q  +Y+ITGESK  V NS F+E++K +G+EV+YM + IDEY +  LKE++GK+LVS TKEGL+L E E EKK +E  K KFEGLCK++K +L                PCC+VT ++GW+ANMERIMKAQALRD +  GYM+ KK +EINP++PI+E LR++ADADKNDK+VKD           +SG SLD
Sbjct:  426 FSKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLSDYVSRMKENQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDEAEKKKREEDKAKFEGLCKLMKSILDSKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVEALRQKADADKNDKAVKDLVILLFETSLLSSGFSLD 664          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_CAEBR (Heat shock protein 90 OS=Caenorhabditis briggsae GN=daf-21 PE=3 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.980e-75
Identity = 143/239 (59.83%), Postives = 177/239 (74.06%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F KNLKLGIHEDSTN+ KL+E LRY +T +G+E TSLK+YV+RMKE Q  IYYITGESK+ V  S F+E++K +G+EVLYM D IDEY V QLKE++GKKLVS TKEGL+L E+E+EKK  E  K  +E LCKVIKD+L                PCC+VT EYGW+ANMERIMKAQALRD+S  GYM++KK +EINP++ IM+ LR+R +ADKNDK+VKD           +SG SL+
Sbjct:  416 FGKNLKLGIHEDSTNRKKLSEFLRY-ATSAGEEPTSLKEYVSRMKENQTQIYYITGESKEVVAASAFVERVKSRGFEVLYMCDPIDEYCVQQLKEYDGKKLVSVTKEGLELPETEEEKKKFEEDKVAYENLCKVIKDILEKKIEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEADKNDKTVKDLVVLLFETALLSSGFSLE 653          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_ANOGA (Heat shock protein 83 OS=Anopheles gambiae GN=Hsp83 PE=3 SV=3)

HSP 1 Score: 281.182 bits (718), Expect = 3.891e-75
Identity = 140/239 (58.58%), Postives = 176/239 (73.64%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKNLKLG+HEDS N+ KLA+LLR++++ SGDE  SL DYV RMKE Q  IY+ITGES   V+NS F+E++KK+G+EV+YM + IDEY + QLKE++GK+LVS TKEGL+L E E EKK +E  K KFE LCKV+K VL                PCC+VT +YGW+ANMERIMKAQALRD+S  GYM+ KK +EINP++ I+E LR+RA+ADKNDK+VKD           +SG SLD
Sbjct:  421 FSKNLKLGVHEDSQNRQKLADLLRFNTSASGDEYCSLNDYVGRMKENQTQIYFITGESIDQVKNSAFVERVKKRGFEVIYMTEPIDEYVIQQLKEYKGKQLVSVTKEGLELPEDEAEKKKREEDKAKFENLCKVMKSVLESKVEKVMVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLD 659          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_CAEEL (Heat shock protein 90 OS=Caenorhabditis elegans GN=daf-21 PE=1 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.132e-74
Identity = 143/239 (59.83%), Postives = 173/239 (72.38%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F KNLKLGIHEDSTN+ KL++ LRY ST +GDE TSLK+YV+RMKE Q  IYYITGESK  V  S F+E++K +G+EVLYM D IDEY V QLKE++GKKLVS TKEGL+L E+E+EKK  E  K  +E LCKVIKD+L                PCC+VT EYGW+ANMERIMKAQALRD+S  GYM++KK +EINP++ IM+ LR R + DKNDK+VKD            SG SL+
Sbjct:  412 FGKNLKLGIHEDSTNRKKLSDFLRY-STSAGDEPTSLKEYVSRMKENQTQIYYITGESKDVVAASAFVERVKSRGFEVLYMCDPIDEYCVQQLKEYDGKKLVSVTKEGLELPETEEEKKKFEEDKVAYENLCKVIKDILEKKVEKVGVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRDRVEVDKNDKTVKDLVVLLFETALLASGFSLE 649          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HS90A_CRIGR2.879e-7860.25Heat shock protein HSP 90-alpha OS=Cricetulus gris... [more]
HSP90_EIMTE3.760e-7862.34Heat shock protein 90 OS=Eimeria tenella GN=HSP90 ... [more]
H90A1_DANRE6.414e-7858.58Heat shock protein HSP 90-alpha 1 OS=Danio rerio G... [more]
HSP90_BRUPA2.437e-7758.58Heat shock protein 90 OS=Brugia pahangi GN=HSP90 P... [more]
HSP90_THEAN3.183e-7762.34Heat shock protein 90 OS=Theileria annulata GN=TA1... [more]
HSP90_THEPA1.210e-7661.92Heat shock protein 90 OS=Theileria parva GN=TP02_0... [more]
HSP83_DROPS1.337e-7556.49Heat shock protein 83 OS=Drosophila pseudoobscura ... [more]
HSP90_CAEBR2.980e-7559.83Heat shock protein 90 OS=Caenorhabditis briggsae G... [more]
HSP83_ANOGA3.891e-7558.58Heat shock protein 83 OS=Anopheles gambiae GN=Hsp8... [more]
HSP90_CAEEL1.132e-7459.83Heat shock protein 90 OS=Caenorhabditis elegans GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top