FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_METNO (Chaperone protein htpG OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=htpG PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.456e-13
Identity = 56/211 (26.54%), Postives = 98/211 (46.45%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRA 634
            +F   LK GI ED+  +  +A L+R+ S+ + +  TS  DYV+RMK  Q  IY + G+  KA+ +S  +E  + +G EVL + D +D +   +L +F+GK + S T+    L     E +  E        L   +K++L                   L     G    M+R+++       +  G+ +    +E+NP + ++  L +RA
Sbjct:  366 AFGPVLKEGIWEDAEQRDDIAGLIRFRSS-AVEGWTSFADYVSRMKPNQEAIYILVGDDTKALASSAQIEGFRARGIEVLLLSDHVDAFWPERLDKFDGKPIRSITQSADDLSAFAPEGE-SEGEAADLADLVPKLKEILKDDVTDVRASQRLVESAVLLSASSGGPDLQMQRLLR------RAGRGFGAGLPVLELNPRHALVRRLAERA 568          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_NEOSM (Chaperone protein htpG OS=Neorickettsia sennetsu (strain Miyayama) GN=htpG PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.532e-13
Identity = 53/219 (24.20%), Postives = 103/219 (47.03%), Query Frame = 2
Query:    2 SFSKNLKLGIHE--DSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKE----KFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADA 640
            +F   LK G+ E   +  + +L  L R++S K  ++L SL +Y+  M   Q +IY +   S ++ +NSP LE    +G +VL+  D +D++ +    E++   + S T+  + LD   + +K  + +++    + + L   +++VL                P CL   +      ME+ M  Q         +  SKK +EIN  +P++ ++  + D+
Sbjct:  370 NFGAVLKEGLCEAMPTDERERLFALCRFYSLKK-EKLISLDEYIQDMHPEQKEIYCLCSTSFESAKNSPQLEGFVSRGLDVLFFTDPVDDFWISVSHEYKSYNIKSITRSSIDLDAFAELEKAGQEVQQHHDKEIDRLIAKMQEVLKDEVESVRISKRLTESPVCLAVPDGAMDIRMEKFMLEQKQL------HSRSKKILEINASHPVIGKIIGKVDS 581          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_CAMHC (Chaperone protein htpG OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=htpG PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.609e-12
Identity = 50/149 (33.56%), Postives = 77/149 (51.68%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSA-------TKEGLKLDESEDEKKMKETLKEKFEG--LCKVIKDVLG 424
            F K LK G+   ST K ++ +L  + S+K+G EL  L +Y   M   Q +IYYI+G   + ++NSP LE+   K  EVL   D ID   +  + EF+   + S         K  +   + E  +K+KE LK+K +   + K +K+ LG
Sbjct:  377 FGKVLKEGLWGFSTEKDEILKLCLFKSSKTG-ELIDLAEYKKSMAAEQKEIYYISGGKAETLKNSPLLEEFNAKNIEVLICDDEIDTIIMPMIGEFDKTPIKSVMDADFSDDKGEISAQDLEIAEKIKENLKDKVKDVKISKRLKNALG 524          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: TRAP1_DICDI (TNF receptor-associated protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=trap1 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.102e-12
Identity = 53/218 (24.31%), Postives = 106/218 (48.62%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHS----TKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSA-TKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F    K GI  D   K ++++LLR+ S    T S  +  SL+ YV+RMK  Q +IY+++  ++    +SP+ E  + K  EV+++ +A+DE+ +  +  F  KK+VS  +KE  +   +  +KK +   +++ +     +  V                 P  ++  E   +AN  R++K           + + K+ +E N  +PI+ +L ++ +++
Sbjct:  459 FGGFFKEGIITDFKWKDEISKLLRFESSNGSTASKTDAVSLEQYVSRMKPEQKNIYFLSVPNRAVGLSSPYYEPFQLKDIEVIFLYNAVDEFVLTNVGHFGDKKIVSVESKEAEEFLATNQDKKTETLSQDEIDKFLSWVSTVASDKVTQAKSTTRSISSPAIIIDHE---SANFRRMLKMV----EPGKQHETPKQVVEFNMNHPIILKLVQQTESN 669          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_METNO1.456e-1326.54Chaperone protein htpG OS=Methylobacterium nodulan... [more]
HTPG_NEOSM5.532e-1324.20Chaperone protein htpG OS=Neorickettsia sennetsu (... [more]
HTPG_CAMHC1.609e-1233.56Chaperone protein htpG OS=Campylobacter hominis (s... [more]
TRAP1_DICDI2.102e-1224.31TNF receptor-associated protein 1 homolog, mitocho... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top