FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_DROME (Heat shock protein 83 OS=Drosophila melanogaster GN=Hsp83 PE=1 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.132e-74
Identity = 133/239 (55.65%), Postives = 174/239 (72.80%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKNLKLG+HEDS N+ KLA+ LR+H++ SGD+  SL DYV+RMK+ Q  +Y+ITGESK  V NS F+E++K +G+EV+YM + IDEY +  LKE++GK+LVS TKEGL+L E E EKK +E  K KFE LCK++K +L                PCC+VT ++GW+ANMERIMKAQALRD +  GYM+ KK +EINP++PI+E LR++ADADKNDK+VKD           +SG SLD
Sbjct:  426 FSKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLD 664          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP85_TRYCR (Heat shock-like 85 kDa protein OS=Trypanosoma cruzi PE=3 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 2.522e-74
Identity = 132/239 (55.23%), Postives = 178/239 (74.48%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F KN+KLGIHEDS N+ KL ELLR+HS++SG+++T+LKDYVTRMKEGQ  IYY+TG+SKK +E SPF+E+ +++G+EVL+M + IDEY + Q+K+FE KK    TKEG+  +E+E+EKK +E  K  +E LCK +KDVLG               PC LVT E+GW+A+ME+IM+ QALRD+SM+ YM SKKTMEINP +PI++EL++R +AD+NDK+VKD           TSG +LD
Sbjct:  416 FGKNVKLGIHEDSANRKKLMELLRFHSSESGEDMTTLKDYVTRMKEGQKCIYYVTGDSKKKLETSPFIEQARRRGFEVLFMTEPIDEYVMQQVKDFEDKKFACLTKEGVHFEETEEEKKQREEEKTAYERLCKAMKDVLGDKVEKVVVSERLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMSAYMMSKKTMEINPAHPIVKELKRRVEADENDKAVKDLVYLLFDTALLTSGFTLD 654          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_DROAV (Heat shock protein 83 OS=Drosophila auraria GN=Hsp83 PE=3 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 9.585e-74
Identity = 132/239 (55.23%), Postives = 173/239 (72.38%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKNLKLG+HEDS N+ KLA+ LR+H++ SGD+  SL DYV+RMKE Q  +Y+ITGESK  V NS F+E++K +G+EV+YM + IDEY +  LKE++GK+LVS TKEGL+L E + EKK +E  K KFE LCK++  +L                PCC+VT ++GW+ANMERIMKAQALRD +  GYM+ KK +EINP++PI+E LR++ADADKNDK+VKD           +SG SLD
Sbjct:  425 FSKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLSDYVSRMKENQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDDAEKKKREEDKAKFESLCKLMNAILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLD 663          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_TRYBB (Heat shock protein 83 OS=Trypanosoma brucei brucei GN=HSP83 PE=3 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.808e-72
Identity = 131/239 (54.81%), Postives = 175/239 (73.22%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            FSKN+KLGIHEDSTN+ KL ELLR+HS++SG+E+T+LKDYVTRMKEGQ  IYY+TG+SKK +E SPF+E+ +++G EVL+M D IDEY + Q+K+FE KK    TKEG+  +E+E+EKK +E  K  +E LCK +K+VLG               PC LVT E+GW+A+ME+IM+ QALRD+SM+ YM  KKTMEIN  + I++EL++R +AD+NDK+ KD           TSG +LD
Sbjct:  416 FSKNVKLGIHEDSTNRKKLMELLRFHSSESGEEMTTLKDYVTRMKEGQKCIYYVTGDSKKKLETSPFIEQARRRGMEVLFMTDPIDEYVMQQVKDFEDKKFACLTKEGVHFEETEEEKKQREEEKASYERLCKAMKEVLGDKVEKVVVSDRLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMSAYMMRKKTMEINTTHAIVKELKRRVEADENDKAAKDLIFLLFDTSLLTSGFTLD 654          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_PODAN (Heat shock protein 90 homolog OS=Podospora anserina GN=MOD-E PE=3 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 4.027e-72
Identity = 136/241 (56.43%), Postives = 182/241 (75.52%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD-KNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKN+KLGIHEDS N+  LA+LLR++STKSGDE TSL DYVTRM E Q ++YYITGES KAV  SPFL+ LK+KG+EVL++VD IDEYA+ QLKEFEGKKLV  TK+  +L+E+E+EKK +E  +++++GL K +K+VLG               PC + TG++GW+ANMERIMKAQALRD SM+ YMSSKKT EI+P++PI++EL+++ +AD +NDK+VK             SG +++
Sbjct:  412 AFSKNIKLGIHEDSQNRNTLAKLLRFNSTKSGDEQTSLSDYVTRMPEHQKNMYYITGESIKAVSKSPFLDSLKEKGFEVLFLVDPIDEYAMTQLKEFEGKKLVDITKD-FELEETEEEKKQREAEEKEYDGLAKALKNVLGDKVEKVVVSHKLVGAPCAIRTGQFGWSANMERIMKAQALRDTSMSSYMSSKKTFEISPKSPIIKELKQKVEADGENDKTVKSIVQLLFETSLLVSGFTIE 651          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_LEIIN (Heat shock protein 83-1 OS=Leishmania infantum GN=HSP83-1 PE=3 SV=2)

HSP 1 Score: 268.855 bits (686), Expect = 1.999e-71
Identity = 129/239 (53.97%), Postives = 174/239 (72.80%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F KN+KLGIH+D+ N+ KL E +R++S++SG+E+T+LKDYVTRMK GQ  IYYITG+SKK +E+SPF+E+ K++G EVL+M + IDEY + Q+K+FE KK    TKEG+  +ESE+EK+ +E  K   E LCK +K+VLG               PC LVT E+GW+A+ME+IM+ QALRD+SMA YM SKKTME+NP +PI++ELR+R DAD+NDK+VKD           TSG  L+
Sbjct:  412 FGKNIKLGIHQDTANRKKLMEFVRFYSSESGEEMTTLKDYVTRMKAGQKSIYYITGDSKKKLESSPFIEQAKRRGLEVLFMTEPIDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSECLSTSPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVDADENDKAVKDLVFLLFDTSLLTSGFQLE 650          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_LEIAM (Heat shock protein 83 OS=Leishmania amazonensis GN=HSP83 PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 2.610e-71
Identity = 129/239 (53.97%), Postives = 175/239 (73.22%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F KN+KLGIHED+ N+ KL ELLR++ST+SG+ +T+LKDYVTRMK  QN IYYITG+SKK +E+SPF+E+ K++G+EVL+M +  DEY + Q+K+FE KK    TKEG+  +ESE+EK+ +E  K   E LCK +K+VLG               PC LVT E+GW+A+ME++M+ QALRD+SMA YM SKKTME+NP++PI++ELR+R +AD+NDK+VKD           TSG  L+
Sbjct:  413 FGKNIKLGIHEDTANRKKLMELLRFYSTESGEVMTTLKDYVTRMKAEQNSIYYITGDSKKKLESSPFIEQAKRRGFEVLFMTEPYDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKRQREEEKATCEKLCKTMKEVLGDKVEKVTVSERLSTSPCILVTSEFGWSAHMEQMMRNQALRDSSMAQYMMSKKTMELNPKHPIIKELRRRVEADENDKAVKDLVFLLFDTSLLTSGFQLE 651          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_SCHPO (Heat shock protein 90 homolog OS=Schizosaccharomyces pombe GN=swo1 PE=1 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 5.815e-71
Identity = 134/241 (55.60%), Postives = 178/241 (73.86%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD-KNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHED+ N+  LA+LLRY+S  S D+L SL+DY+T+M E Q +IY+ITGESK+AVENSPFLE  + K ++VL+MVD IDEYAV QLKEFEGKKLV+ TK+GL+L+E+++EK  +E L++++E   K +K +LG               PC L TG+YGW+ANMERIMKAQALRD SM+ YMSS+KT EINP++PI+ EL+K+ + +   D+SVKD           +SG +LD
Sbjct:  415 AFSKNLKLGIHEDAANRPALAKLLRYNSLNSPDDLISLEDYITKMPEHQKNIYFITGESKQAVENSPFLEIFRAKKFDVLFMVDPIDEYAVTQLKEFEGKKLVNITKDGLELEETDEEKAAREKLEKEYEEFAKQLKTILGDKVEKVVVSNKIVGSPCLLTTGQYGWSANMERIMKAQALRDTSMSAYMSSRKTFEINPKSPIIAELKKKVEENGAEDRSVKDLATILYETALLSSGFTLD 655          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_LEIDO (Heat shock protein 83 (Fragment) OS=Leishmania donovani GN=HSP83 PE=2 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.871e-69
Identity = 127/239 (53.14%), Postives = 171/239 (71.55%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F KN+KLGIHED+ N  KL E LR++ST+SG E+T+LKDYVTRMKEGQ  IYYITG+SKK +E+SPF+E+ +++G EVL+M + IDEY + Q+K+FE KK    TKEG+  +ESE+EK+ +E  K   E  CK +K+VLG               PC LVT E+GW+A+ME+IM+ QA+RD+SM+ YM SKKTME+NP +PI++ LR+R +AD+NDK+VKD           TSG  L+
Sbjct:  165 FGKNIKLGIHEDTANPKKLMEFLRFYSTESGLEMTTLKDYVTRMKEGQKSIYYITGDSKKKLESSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKQQREEEKAACEKRCKTMKEVLGDKVEKVTVSDRLSTSPCILVTSEFGWSAHMEQIMRNQAVRDSSMSAYMMSKKTMELNPRHPIIKVLRRRVEADENDKAVKDLVFLLFDTSLLTSGFQLE 403          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_CANAL (Heat shock protein 90 homolog OS=Candida albicans GN=HSP90 PE=1 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.584e-68
Identity = 134/241 (55.60%), Postives = 174/241 (72.20%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD-KNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKN+KLGIHED+ N+  LA+LLR++STKS +E+TSL DYVTRM E Q +IYYITGES KAVE SPFL+ LK K +EVL+MVD IDEYA+ QLKEFE KKLV  TK+  +L+ES++EK  +E   +++E L K +KD+LG               P  + TG++GW+ANMERIMKAQALRD +M+ YMSSKKT EI+P +PI++EL+K+ + D   DK+VKD           TSG +LD
Sbjct:  417 AFSKNIKLGIHEDAQNRQSLAKLLRFYSTKSSEEMTSLSDYVTRMPEHQKNIYYITGESIKAVEKSPFLDALKAKNFEVLFMVDPIDEYAMTQLKEFEDKKLVDITKD-FELEESDEEKAAREKEIKEYEPLTKALKDILGDQVEKVVVSYKLVDAPAAIRTGQFGWSANMERIMKAQALRDTTMSSYMSSKKTFEISPSSPIIKELKKKVETDGAEDKTVKDLTTLLFDTALLTSGFTLD 656          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HSP83_DROME1.132e-7455.65Heat shock protein 83 OS=Drosophila melanogaster G... [more]
HSP85_TRYCR2.522e-7455.23Heat shock-like 85 kDa protein OS=Trypanosoma cruz... [more]
HSP83_DROAV9.585e-7455.23Heat shock protein 83 OS=Drosophila auraria GN=Hsp... [more]
HSP83_TRYBB1.808e-7254.81Heat shock protein 83 OS=Trypanosoma brucei brucei... [more]
HSP90_PODAN4.027e-7256.43Heat shock protein 90 homolog OS=Podospora anserin... [more]
HSP83_LEIIN1.999e-7153.97Heat shock protein 83-1 OS=Leishmania infantum GN=... [more]
HSP83_LEIAM2.610e-7153.97Heat shock protein 83 OS=Leishmania amazonensis GN... [more]
HSP90_SCHPO5.815e-7155.60Heat shock protein 90 homolog OS=Schizosaccharomyc... [more]
HSP83_LEIDO1.871e-6953.14Heat shock protein 83 (Fragment) OS=Leishmania don... [more]
HSP90_CANAL1.584e-6855.60Heat shock protein 90 homolog OS=Candida albicans ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top