FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_ASPFU (Heat shock protein 90 OS=Aspergillus fumigatus GN=hsp90 PE=1 SV=3)

HSP 1 Score: 258.455 bits (659), Expect = 2.701e-68
Identity = 132/241 (54.77%), Postives = 175/241 (72.61%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD-KNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKN+KLGIHED+ N+  LA+LLRY STKSGDE TSL DYVTRM E Q  IYYITGES KAV  SPFL+ LK+K +EVL++VD IDEYA  QLKEF+GKKLV  TK+  +L+E+E+EK  +E  ++++E L K +K++LG               PC + TG++GW+ANMERIMKAQALRD SM+ YMSSKKT EI+P++ I++EL+K+ +AD +ND++VK             SG +++
Sbjct:  417 AFSKNIKLGIHEDAQNRQTLAKLLRYQSTKSGDEATSLADYVTRMPEHQKQIYYITGESIKAVAKSPFLDSLKQKNFEVLFLVDPIDEYAFTQLKEFDGKKLVDITKD-FELEETEEEKAEREKEEKEYENLAKSLKNILGDKVEKVVVSHKLVGSPCAIRTGQFGWSANMERIMKAQALRDTSMSSYMSSKKTFEISPKSSIIKELKKKVEADGENDRTVKSITQLLFETSLLVSGFTIE 656          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP82_YEAST (ATP-dependent molecular chaperone HSP82 OS=Saccharomyces cerevisiae GN=HSP82 PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.528e-68
Identity = 135/241 (56.02%), Postives = 173/241 (71.78%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD-ADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKN+KLG+HED+ N+  LA+LLRY+STKS DELTSL DYVTRM E Q +IYYITGES KAVE SPFL+ LK K +EVL++ D IDEYA  QLKEFEGK LV  TK+  +L+E+++EK  +E   +++E L K +K++LG               P  + TG++GW+ANMERIMKAQALRD+SM+ YMSSKKT EI+P++PI++EL+KR D     DK+VKD           TSG SLD
Sbjct:  420 AFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD-FELEETDEEKAEREKEIKEYEPLTKALKEILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKLLYETALLTSGFSLD 659          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSC82_YEAST (ATP-dependent molecular chaperone HSC82 OS=Saccharomyces cerevisiae GN=HSC82 PE=1 SV=4)

HSP 1 Score: 256.914 bits (655), Expect = 7.859e-68
Identity = 134/241 (55.60%), Postives = 173/241 (71.78%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD-ADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +F+KN+KLG+HED+ N+  LA+LLRY+STKS DELTSL DYVTRM E Q +IYYITGES KAVE SPFL+ LK K +EVL++ D IDEYA  QLKEFEGK LV  TK+  +L+E+++EK  +E   +++E L K +KD+LG               P  + TG++GW+ANMERIMKAQALRD+SM+ YMSSKKT EI+P++PI++EL+KR D     DK+VKD           TSG SL+
Sbjct:  416 AFAKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD-FELEETDEEKAEREKEIKEYEPLTKALKDILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLFETALLTSGFSLE 655          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP82_ASHGO (Heat shock protein HSP82 OS=Ashbya gossypii GN=HSP82 PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.140e-65
Identity = 131/241 (54.36%), Postives = 172/241 (71.37%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRA-DADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +F+KN+KLGIHEDS N+  LA+LLRY+STKS DE TSL DYVTRM E Q ++Y+ITGES KAVE SPFL+ LK K +EVL++VD IDEYA  QLKEFEGK+LV  TK+  +L+ESE+EKK +E   ++FE L   +K+VLG               P  + TG++GW+ANMERIMKAQALRD++M+ YM+SKK  EI+P++ I++EL+KR  D    D++VKD           TSG +L+
Sbjct:  415 AFAKNIKLGIHEDSQNRASLAKLLRYNSTKSVDEQTSLADYVTRMPEHQKNVYFITGESIKAVEKSPFLDALKAKNFEVLFLVDPIDEYAFQQLKEFEGKQLVDITKD-FELEESEEEKKQREEEIKEFEPLTAALKEVLGDQVEKVVVSYKLIDAPAAIRTGQFGWSANMERIMKAQALRDSTMSSYMASKKIFEISPKSAIIKELKKRVEDNGAQDRTVKDLTSLLYETALLTSGFTLE 654          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: H90B3_HUMAN (Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens GN=HSP90AB3P PE=5 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.455e-61
Identity = 115/200 (57.50%), Postives = 144/200 (72.00%), Query Frame = 2
Query:  122 YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            YV+ MKE Q   YYITGESK+ V NS F+E+++K+G+EV+YM + IDEY V QLKEF+GK LVS TKEGL+L E E+EKK  E  KEKFE LCK++K++L                PCC+VT  YGWTANME+IMKAQALRDNS  GYM +KK +EINP++PIME LR++A+ADKNDK+VKD           +SG SL+
Sbjct:  345 YVSHMKETQKSTYYITGESKEQVANSAFVERVRKQGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKEKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMEQIMKAQALRDNSTMGYMMAKKHLEINPDHPIMETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLE 544          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP82_AJECA (Heat shock protein 82 OS=Ajellomyces capsulata GN=HSP82 PE=3 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.145e-57
Identity = 111/194 (57.22%), Postives = 146/194 (75.26%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKT 583
            +FSKN+KLG+HED+ N+  LA+LLRY+STKSGDE TSL DYVTRM E    IYYITGES KAV+ SPFL+ LK+K +EVL++VD  DEYA+ QLKEF+GKKLV  TK+  +L+E+E+EKK +E  ++++EGL K ++++LG               PC + TG++GW+ANMERIMKAQALRD SM+   SS+ T
Sbjct:  412 AFSKNIKLGVHEDAQNRPALAKLLRYNSTKSGDETTSLTDYVTRMPEHHKTIYYITGESLKAVQKSPFLDTLKEKNFEVLFLVDPNDEYAMTQLKEFDGKKLVDITKD-FELEETEEEKKDREAEEKEYEGLAKSLENILGDKVEKVVVSHKLIGSPCAIRTGQFGWSANMERIMKAQALRDTSMSSRRSSRPT 604          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_CANFA (Endoplasmin OS=Canis familiaris GN=HSP90B1 PE=1 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.078e-52
Identity = 102/225 (45.33%), Postives = 148/225 (65.78%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E ++++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P+++++ +R   D++DK+V D
Sbjct:  488 FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAIEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIKDMLRRVKEDEDDKTVSD 712          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_PIG (Endoplasmin OS=Sus scrofa GN=HSP90B1 PE=2 SV=3)

HSP 1 Score: 204.912 bits (520), Expect = 3.544e-52
Identity = 102/225 (45.33%), Postives = 147/225 (65.33%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E ++++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P++ ++ +R   D++DK+V D
Sbjct:  488 FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKSKENREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVSD 712          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_BOVIN (Endoplasmin OS=Bos taurus GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.544e-52
Identity = 102/225 (45.33%), Postives = 147/225 (65.33%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E ++++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P++ ++ +R   D++DK+V D
Sbjct:  488 FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDMTSLDQYVERMKEKQDKIYFMAGASRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKSKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVSD 712          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_RAT (Endoplasmin OS=Rattus norvegicus GN=Hsp90b1 PE=1 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 4.629e-52
Identity = 102/225 (45.33%), Postives = 146/225 (64.89%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E  +++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P++ ++ +R   D++DK+V D
Sbjct:  488 FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKSKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVMD 712          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HSP90_ASPFU2.701e-6854.77Heat shock protein 90 OS=Aspergillus fumigatus GN=... [more]
HSP82_YEAST3.528e-6856.02ATP-dependent molecular chaperone HSP82 OS=Sacchar... [more]
HSC82_YEAST7.859e-6855.60ATP-dependent molecular chaperone HSC82 OS=Sacchar... [more]
HSP82_ASHGO2.140e-6554.36Heat shock protein HSP82 OS=Ashbya gossypii GN=HSP... [more]
H90B3_HUMAN5.455e-6157.50Putative heat shock protein HSP 90-beta-3 OS=Homo ... [more]
HSP82_AJECA2.145e-5757.22Heat shock protein 82 OS=Ajellomyces capsulata GN=... [more]
ENPL_CANFA2.078e-5245.33Endoplasmin OS=Canis familiaris GN=HSP90B1 PE=1 SV... [more]
ENPL_PIG3.544e-5245.33Endoplasmin OS=Sus scrofa GN=HSP90B1 PE=2 SV=3[more]
ENPL_BOVIN3.544e-5245.33Endoplasmin OS=Bos taurus GN=HSP90B1 PE=2 SV=1[more]
ENPL_RAT4.629e-5245.33Endoplasmin OS=Rattus norvegicus GN=Hsp90b1 PE=1 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top