FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_CATRO (Endoplasmin homolog OS=Catharanthus roseus GN=HSP90 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 4.629e-52
Identity = 108/240 (45.00%), Postives = 149/240 (62.08%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVL-GXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F K++KLGI ED+ N+ +LA+LLR+ STKS  +LTSL  Y++RMK GQ DI+YITG SK+ +E SPFLE+L KK YEV+   D +DEY +  L ++E KK  + +KEGLK+ +   +K++KE+ KE    L K  K  L                 PC +VT +YGW++NMERIM++Q L D S   YM  K+ +EINP +PI++ELR+R   D  D+SVK             SG  L+
Sbjct:  522 FGKSIKLGIIEDAANRNRLAKLLRFESTKSEGKLTSLDQYISRMKSGQKDIFYITGTSKEQLEKSPFLERLTKKNYEVILFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKIGKDSKDKELKESFKE----LTKWWKGALASENVDDVKISNRLANTPCVVVTSKYGWSSNMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDAEDESVKQTARLMYQTALMESGFMLN 757          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_PONAB (Endoplasmin OS=Pongo abelii GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 7.896e-52
Identity = 102/225 (45.33%), Postives = 147/225 (65.33%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E ++++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P++ ++ +R   D++DK+V D
Sbjct:  488 FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAIEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLD 712          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_MOUSE (Endoplasmin OS=Mus musculus GN=Hsp90b1 PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 7.896e-52
Identity = 102/225 (45.33%), Postives = 146/225 (64.89%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E  +++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P++ ++ +R   D++DK+V D
Sbjct:  488 FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVMD 712          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_MESAU (Endoplasmin (Fragment) OS=Mesocricetus auratus GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.031e-51
Identity = 102/225 (45.33%), Postives = 146/225 (64.89%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E  +++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P++ ++ +R   D++DK+V D
Sbjct:   85 FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKENREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVLD 309          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_MACFA (Endoplasmin OS=Macaca fascicularis GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.031e-51
Identity = 102/225 (45.33%), Postives = 147/225 (65.33%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E ++++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P++ ++ +R   D++DK+V D
Sbjct:  488 FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLD 712          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_HUMAN (Endoplasmin OS=Homo sapiens GN=HSP90B1 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.031e-51
Identity = 102/225 (45.33%), Postives = 147/225 (65.33%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E ++++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P++ ++ +R   D++DK+V D
Sbjct:  488 FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLD 712          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_CHICK (Endoplasmin OS=Gallus gallus GN=HSP90B1 PE=1 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.759e-51
Identity = 102/225 (45.33%), Postives = 147/225 (65.33%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQAL---RDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T+LA+LLR+ S+     LTSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K +ESE  K+ +E L+++FE L   +KD  L                PC LV  +YGW+ NMERIMKAQA    +D S   Y S KKT EINP +P+++++ +R   +++DK+V D
Sbjct:  487 FGTNVKLGVIEDHSNRTRLAKLLRFQSSHHESNLTSLDQYVERMKEKQDKIYFMAGASRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFEESEKSKESREALEKEFEPLLNWMKDKALKDKIEKAVLSQRLTQSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIKDMLRRVKENEDDKTVSD 711          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_ARATH (Endoplasmin homolog OS=Arabidopsis thaliana GN=SHD PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 8.730e-51
Identity = 101/222 (45.50%), Postives = 147/222 (66.22%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIK-DVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F K++KLGI ED+ N+ +LA+LLR+ +TKS  +LTSL  Y+ RMK+ Q DI+YITG SK+ +E SPFLE+L KKGYEV++  D +DEY +  L ++E KK  + +KEGLK+ +   +K++KE  KE    L K  K ++                 PC +VT ++GW+ANMERIM++Q L D +   YM  K+ +EINP +PI++EL+ R  +D  D+SVK+
Sbjct:  518 FGKSVKLGIIEDAANRNRLAKLLRFETTKSDGKLTSLDQYIKRMKKSQKDIFYITGSSKEQLEKSPFLERLIKKGYEVIFFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKVGKDSKDKELKEAFKE----LTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKE 735          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_HORVU (Endoplasmin homolog OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.945e-50
Identity = 103/238 (43.28%), Postives = 148/238 (62.18%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSL 718
            F K++KLGI ED+TN+ +LA+LLR+ S+KS  +L SL +Y++RMK GQ DI+Y+TG SK+ +E SPFLE+L KK YEV+Y  D +DEY +  L ++E KK  + +KEGLKL +    K +KE+ KE  +   K + D  G               PC +VT +YGW++NME+IM+AQ L D S   YM  K+ +EINP +PI++ELR +   D + + +K             SG +L
Sbjct:  515 FGKSVKLGIIEDATNRNRLAKLLRFESSKSDGKLVSLDEYISRMKSGQKDIFYLTGSSKEQLEKSPFLEQLTKKNYEVIYFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKAL-DTEG--IDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNL 749          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_RABIT (Endoplasmin (Fragment) OS=Oryctolagus cuniculus GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 9.034e-48
Identity = 95/213 (44.60%), Postives = 139/213 (65.26%), Query Frame = 2
Query:   14 NLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALR-DNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            N+KLG+ ED +N+T+LA+LLR+ S+    ++TSL  YV RMKE Q+ IY++ G S+K  E+SPF+E+L KKGYEV+Y+ + +DEY +  L EF+GK+  +  KEG+K DESE  K+ +E  +++FE L   +KD  L                PC LV  +YGW+ANMERIMKAQA +       Y +S+KT EINP +P++ ++ +  + DK
Sbjct:  410 NIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGASRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSANMERIMKAQAYQTGKDSTKYYASQKTFEINPRHPLIRDMLRIKEDDK 622          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
ENPL_CATRO4.629e-5245.00Endoplasmin homolog OS=Catharanthus roseus GN=HSP9... [more]
ENPL_PONAB7.896e-5245.33Endoplasmin OS=Pongo abelii GN=HSP90B1 PE=2 SV=1[more]
ENPL_MOUSE7.896e-5245.33Endoplasmin OS=Mus musculus GN=Hsp90b1 PE=1 SV=2[more]
ENPL_MESAU1.031e-5145.33Endoplasmin (Fragment) OS=Mesocricetus auratus GN=... [more]
ENPL_MACFA1.031e-5145.33Endoplasmin OS=Macaca fascicularis GN=HSP90B1 PE=2... [more]
ENPL_HUMAN1.031e-5145.33Endoplasmin OS=Homo sapiens GN=HSP90B1 PE=1 SV=1[more]
ENPL_CHICK1.759e-5145.33Endoplasmin OS=Gallus gallus GN=HSP90B1 PE=1 SV=1[more]
ENPL_ARATH8.730e-5145.50Endoplasmin homolog OS=Arabidopsis thaliana GN=SHD... [more]
ENPL_HORVU1.945e-5043.28Endoplasmin homolog OS=Hordeum vulgare PE=2 SV=1[more]
ENPL_RABIT9.034e-4844.60Endoplasmin (Fragment) OS=Oryctolagus cuniculus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top