FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPL_DICDI (Endoplasmin homolog OS=Dictyostelium discoideum GN=grp94 PE=2 SV=2)

HSP 1 Score: 166.392 bits (420), Expect = 1.397e-40
Identity = 96/241 (39.83%), Postives = 143/241 (59.34%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK-KLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRA-DADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F  ++KLG  ED  NK +L + L + S+K  +ELT+   YV RMKEGQ+ IY+ITG+SK +VE SP +E+  KKGYEVL++VD IDEY V QL +F+ K K  +  + G+K +E ++E+  ++   E+F+ L   +K  L                P  LV+  +G TAN ERIMKAQA + N+   + +SKK MEINP +P++++L  R  +  + D++ K            T+G S+D
Sbjct:  470 FGSSMKLGAIEDQANKKRLTKYLLFPSSK--EELTTFAGYVERMKEGQDQIYFITGKSKDSVEASPLIEQAIKKGYEVLFLVDPIDEYLVPQLDKFDDKYKFTNLARSGVKFNEDKEEEDQRKQTAEEFKPLLSYLKKTLSDKLEKVVISKVLADSPSILVSNSWGVTANQERIMKAQAHQANAQPQF-NSKKIMEINPSHPLIKKLLNRLNEFGEEDETTKVSAHVLYETSALTAGYSID 707          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_GEOUR (Chaperone protein htpG OS=Geobacter uraniireducens (strain Rf4) GN=htpG PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 9.055e-40
Identity = 89/225 (39.56%), Postives = 132/225 (58.67%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKS-GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKK---MKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F   LK G+H D  NK KL EL+ + S+K+      SLK+YV RM E Q +IYYITG S+ A+ENSP LE  +KKG+EVLYM D +DE+ V  L +++GKKL +  +  L+LD +E++K+    +E  K++++G+   +K+ L                 CCLV  EYG  ANME+I+KA             SK+ +E+NP++P+M+ L    + DK +  + D
Sbjct:  390 FGPVLKEGVHFDHANKEKLQELILFESSKTEAGNYISLKEYVARMPEAQKEIYYITGASRSALENSPHLEIFRKKGFEVLYMTDPVDEWVVQSLTDYDGKKLHAVDRGDLELDSAEEKKEKEAKQEEAKKQYQGVLDFVKEQLKDKVKEVRFSSRLTDSACCLVADEYGLNANMEKILKAM------NQDVPESKRVLELNPDHPLMQVLSSIFEKDKENPRLAD 608          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_MYXXD (Chaperone protein htpG OS=Myxococcus xanthus (strain DK 1622) GN=htpG PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.708e-38
Identity = 94/239 (39.33%), Postives = 135/239 (56.49%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSL 718
            +F   LK G+  ++  K KL  LLRY S++  + LTSL DYV RMKEGQ  IYY+ GES+KAV +SP LE LK++G+EVLYM D +DE+A   L+EF+GK LVSA +  LKL  ++++KK +E   E  + L   +KDVL                P CLV  E G  A +ER+++ +       AG    K+ +E+NP++P++E L+   D D     V +           T G ++
Sbjct:  385 AFGTVLKEGLATEAEQKDKLGGLLRYESSRE-EGLTSLADYVGRMKEGQEAIYYVYGESRKAVADSPHLEALKQRGFEVLYMTDPVDEWAAQGLREFQGKPLVSALQADLKLQSTDEQKKEQEQHAEGLKTLTSKMKDVLQESVREVRVSDRLTDSPVCLVVPEGGSPAYLERLLQQR----GRGAGMPRVKRILEVNPKHPVIEHLKAVHDRDPAAAQVAEWIELLHDQALLTEGSTI 618          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: H90B4_HUMAN (Putative heat shock protein HSP 90-beta 4 OS=Homo sapiens GN=HSP90AB4P PE=5 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.489e-38
Identity = 84/164 (51.22%), Postives = 107/164 (65.24%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEY 496
            FSK   LGIHEDS N   L+ELL  H+ +SGDE+TSL +YV+ MKE Q  I  I GE K+ V NS F+E+  KKG+EV+YM + IDEY V QLKEF+GK L+S TKEGL+L E E+EKK+ E    KFE LC+++K++L                PC +VT  Y
Sbjct:  341 FSKISWLGIHEDSINWRHLSELLWSHTFQSGDEMTSLSEYVSCMKEAQKSICDIIGECKEQVANSAFVEQEWKKGFEVIYMSEPIDEYCVQQLKEFDGKSLLSVTKEGLELPEDEEEKKIMEESNVKFENLCRLMKEILDKKVERVTISSRLVSSPCRIVTSTY 504          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BDEBA (Chaperone protein htpG OS=Bdellovibrio bacteriovorus GN=htpG PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.888e-37
Identity = 93/212 (43.87%), Postives = 126/212 (59.43%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI----KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRK 628
            F   LK G+  D+ NK KL +LL +HST S D++T++ +YV RMKE Q DIYYITG+S   V NSP+LEKLK+KG+EVL +VD +DE+ V  L EF+GKKL S  +EGL LD +E EK+ KE  K++ E   K +    K  L                P CLV      +A+M+++M   A      AG    K+ MEINP +P+ E++ K
Sbjct:  372 FGATLKEGLPSDAANKEKLQDLLLFHSTSS-DKMTTMDEYVARMKETQKDIYYITGDSLSQVSNSPYLEKLKEKGFEVLLLVDPVDEWVVDALSEFKGKKLQSIMREGLDLDTAE-EKQQKEQEKKQAEVTLKPVLESMKKTLESDVKDVVLSDRLTNTPACLVASSADPSAHMQKLM---AQMGKEYAG-QQVKRIMEINPNHPVFEKMLK 577          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP90_PLAFP (Heat shock 90 kDa protein homolog (Fragment) OS=Plasmodium falciparum (isolate Palo Alto / Uganda) PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.598e-36
Identity = 80/146 (54.79%), Postives = 97/146 (66.44%), Query Frame = 2
Query:  284 KEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            K+F+GKKL   TKEGL +  SE+ KK  ETLK ++EGLCKVIKDVL                PC LVT E+GW+ANMERIMKAQALRDNSM  YM SKK MEIN  +PI+  L+++ADADK+DK+VK            TSG +L+
Sbjct:    1 KDFDGKKLKCCTKEGLDIHHSEEAKKDFETLKAEYEGLCKVIKDVLHKKVEKVVVGQRITDSPCVLVTSEFGWSANMERIMKAQALRDNSMTSYMLSKKIMEINARHPIISALKQKADADKSDKTVKYLIWLLFDTSLLTSGFALE 146          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_AZOSE (Chaperone protein htpG OS=Azoarcus sp. (strain EbN1) GN=htpG PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.087e-36
Identity = 90/211 (42.65%), Postives = 123/211 (58.29%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSG--DELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLK--EKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            F   LK G+ ED  NK K+A LLR+ ST +   DE+ SL DY+ RMKEGQ+ IYY+T ES  A +NSP LE  +KKG EVL + D +DE+ +G L EF+GK LVS  K GL L + EDE + KET K  ++++ L + +K  LG               P CLV  E+    N+ RI+KA   +        +SK  +EINP++P +  L+
Sbjct:  395 FGPVLKEGVGEDFANKDKIAGLLRFASTHADTPDEVVSLADYLARMKEGQDKIYYVTAESFNAAKNSPHLEIFRKKGIEVLLLTDRVDEWVIGNLPEFDGKALVSVAKGGLDLGKLEDEAEKKETEKAADEYKELLEKMKASLGERVKEVRVTHRLTDSPACLVADEHDVGMNLARILKAAGQQ------APASKPILEINPQHPAVMRLK 599          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_THIDA (Chaperone protein htpG OS=Thiobacillus denitrificans (strain ATCC 25259) GN=htpG PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 6.074e-36
Identity = 92/218 (42.20%), Postives = 124/218 (56.88%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDE--LTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F K +K G  ED  NK K+A LLR+ ST +  +  + SLKDYV RMKEGQ  IYYIT +S  A ++SP LE  +KKG EVL + D +DE+  G L EF+GK L S  K GL L E ED  EK  ++  +E  + L + IK +LG               P CLVTGE   +AN+ER++KA      ++      K T+EINP + ++  L   +D D+
Sbjct:  383 FGKVMKEGPGEDFANKEKIAGLLRFASTHTDTDAQVVSLKDYVGRMKEGQTAIYYITADSFAAAQHSPHLEIFRKKGIEVLLLSDRVDEWLTGNLHEFDGKPLKSVAKGGLDLGELEDEAEKTAQKEAEESMKPLVERIKAMLGERVKDVRVTHRLTDSPACLVTGEGDMSANLERLLKAAGQAAPTV------KPTLEINPSHALVTRLDSESDEDR 594          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEHH (Chaperone protein htpG OS=Shewanella halifaxensis (strain HAW-EB4) GN=htpG PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.036e-35
Identity = 91/218 (41.74%), Postives = 123/218 (56.42%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELT--SLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F + LK G  ED  NK ++A LLR+ ST +G+     SL DYV RMKEGQ+ IY+I  +S +A  NSP LE L+KKG EVL M + IDE+ +  L EF+GKKL S T+  L+L E ED  EK+ +E L+ + EGL K +KD LG               P C+V GE   +  M ++M+A             SK T E+NPE+P++  L    D  +
Sbjct:  389 FGQVLKEGPAEDFANKERVAGLLRFASTHTGEATANVSLADYVERMKEGQSKIYFIVADSYEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEFDGKKLHSVTRGDLELGELEDASEKEAQEKLETESEGLVKRVKDSLGDKVSAVKVTTRLTDTPACVVAGEGEMSTQMIKLMQAAG------QDVPESKPTFELNPEHPLVARLNDEQDEQR 600          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_FRATW (Chaperone protein htpG OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=htpG PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.308e-35
Identity = 85/218 (38.99%), Postives = 128/218 (58.72%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            SF + LK G+ +D +NK K+A LLR+ +T+SGD  +  SL DY++RMKEGQ+ IYYIT +S KA  N+P LE  KKKG EV+ M D IDE+ +  L EF+GK + S  K  + LD  E+ + K+  E   + FE + K IK+VL                P C+V  +YG + +M+++M+       S    M  K  +E+N E+ ++++L+  AD +
Sbjct:  378 SFGQVLKEGVSDDYSNKEKIAGLLRFATTQSGDSKQTVSLADYISRMKEGQDTIYYITSDSYKAAANNPQLEAFKKKGIEVILMTDRIDEWMMSTLTEFDGKHMKSIIKGDIDLDKFETPENKEKFEKEAKDFEKVLKEIKEVLKDKVEDVRLSKRLTDSPSCVVVNDYGMSLHMQKMMEEAG---QSFMPGMGMKPILELNAEHNLVQKLKNEADTE 592          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
ENPL_DICDI1.397e-4039.83Endoplasmin homolog OS=Dictyostelium discoideum GN... [more]
HTPG_GEOUR9.055e-4039.56Chaperone protein htpG OS=Geobacter uraniireducens... [more]
HTPG_MYXXD1.708e-3839.33Chaperone protein htpG OS=Myxococcus xanthus (stra... [more]
H90B4_HUMAN6.489e-3851.22Putative heat shock protein HSP 90-beta 4 OS=Homo ... [more]
HTPG_BDEBA1.888e-3743.87Chaperone protein htpG OS=Bdellovibrio bacteriovor... [more]
HSP90_PLAFP1.598e-3654.79Heat shock 90 kDa protein homolog (Fragment) OS=Pl... [more]
HTPG_AZOSE2.087e-3642.65Chaperone protein htpG OS=Azoarcus sp. (strain EbN... [more]
HTPG_THIDA6.074e-3642.20Chaperone protein htpG OS=Thiobacillus denitrifica... [more]
HTPG_SHEHH1.036e-3541.74Chaperone protein htpG OS=Shewanella halifaxensis ... [more]
HTPG_FRATW2.308e-3538.99Chaperone protein htpG OS=Francisella tularensis s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top