FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_FRATT (Chaperone protein htpG OS=Francisella tularensis subsp. tularensis GN=htpG PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.308e-35
Identity = 85/218 (38.99%), Postives = 128/218 (58.72%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            SF + LK G+ +D +NK K+A LLR+ +T+SGD  +  SL DY++RMKEGQ+ IYYIT +S KA  N+P LE  KKKG EV+ M D IDE+ +  L EF+GK + S  K  + LD  E+ + K+  E   + FE + K IK+VL                P C+V  +YG + +M+++M+       S    M  K  +E+N E+ ++++L+  AD +
Sbjct:  378 SFGQVLKEGVSDDYSNKEKIAGLLRFATTQSGDSKQTVSLADYISRMKEGQDTIYYITSDSYKAAANNPQLEAFKKKGIEVILMTDRIDEWMMSTLTEFDGKHMKSIIKGDIDLDRFETPENKEKFEKEAKDFEKVLKEIKEVLKDKVEDVRLSKRLTDSPSCVVVNDYGMSLHMQKMMEEAG---QSFMPGMGMKPILELNAEHNLVQKLKNEADTE 592          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_FRAT1 (Chaperone protein htpG OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=htpG PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.308e-35
Identity = 85/218 (38.99%), Postives = 128/218 (58.72%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            SF + LK G+ +D +NK K+A LLR+ +T+SGD  +  SL DY++RMKEGQ+ IYYIT +S KA  N+P LE  KKKG EV+ M D IDE+ +  L EF+GK + S  K  + LD  E+ + K+  E   + FE + K IK+VL                P C+V  +YG + +M+++M+       S    M  K  +E+N E+ ++++L+  AD +
Sbjct:  378 SFGQVLKEGVSDDYSNKEKIAGLLRFATTQSGDSKQTVSLADYISRMKEGQDTIYYITSDSYKAAANNPQLEAFKKKGIEVILMTDRIDEWMMSTLTEFDGKHMKSIIKGDIDLDRFETPENKEKFEKEAKDFEKVLKEIKEVLKDKVEDVRLSKRLTDSPSCVVVNDYGMSLHMQKMMEEAG---QSFMPGMGMKPILELNAEHNLVQKLKNEADTE 592          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHELP (Chaperone protein htpG OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=htpG PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.014e-35
Identity = 89/217 (41.01%), Postives = 123/217 (56.68%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F + LK G  ED  NK K+A LLR+ ST + +     SL DYV RMKEGQ+ IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L EF+GK+L S T+  L+L E ED  EK+ +E L+ + EGL K +K+VLG               P C+V G    ++ M ++M+A             SK   E+NPE+P+++ L    D +
Sbjct:  389 FGQVLKEGPAEDFANKEKIAGLLRFASTHTNEAAHTVSLSDYVERMKEGQSKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLSEFDGKQLHSVTRGDLELGELEDAAEKEAQEKLETESEGLVKRVKEVLGDKVAEVKVTSRLTDTPACVVAGAGEMSSQMIKLMQAAG------QAVTESKPVFELNPEHPLVKRLDTEQDEE 599          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEDO (Chaperone protein htpG OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=htpG PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.014e-35
Identity = 89/215 (41.40%), Postives = 122/215 (56.74%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELT--SLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  NK ++A LLR+ ST  G   T  SL+DY++RMKEGQ+ IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L EF+GKKL S T+  L+L E ED  +K+ K+ + E+ +GL + +K  LG               P C+V GE   +  M ++M+A             SK T EINP +P++  L   AD
Sbjct:  387 FGQVLKEGPAEDFANKERIAGLLRFASTHEGSAATTVSLEDYISRMKEGQDKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEFKGKKLHSVTRGDLELGELEDAADKEAKDKITEEAKGLVERMKAALGAKVSEVKVTTRLTDTPACVVAGEGEMSTQMIKLMQAAG------QAVPESKPTFEINPNHPLVARLNDEAD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_FRATN (Chaperone protein htpG OS=Francisella tularensis subsp. novicida (strain U112) GN=htpG PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.014e-35
Identity = 86/218 (39.45%), Postives = 129/218 (59.17%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            SF + LK G+ +D +NK K+A LLR+ +T+SGD  +  SL DY++RMKEGQ+ IYYIT +S KA  N+P LE  KKKG EV+ M D IDE+ +  L EF+GK + S  K  + LD  E+ + K+  E   + FE + K IK+VL                P C+V  +YG + +M+++M+        M G M  K  +E+N E+ ++++L+  AD +
Sbjct:  378 SFGQVLKEGVSDDYSNKEKIAGLLRFATTQSGDSKQTVSLADYISRMKEGQDTIYYITSDSYKAAANNPQLEAFKKKGIEVILMTDRIDEWMMSTLTEFDGKHMKSIIKGDIDLDKFETPENKEKFEKETKDFEKVLKEIKEVLKDKVEDVRLSKRLTDSPSCVVVNDYGMSLHMQKMMEEAG--QGFMPG-MGMKPILELNAEHNLVQKLKNEADTE 592          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_FRAP2 (Chaperone protein htpG OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=htpG PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.014e-35
Identity = 87/218 (39.91%), Postives = 129/218 (59.17%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            SF + LK G+ +D +NK K+A LLR+ +T+SGD  +  SL DYV+RMKEGQ+ IYYIT +S KA  N+P LE  KKKG EV+ M D IDE+ +  L EF+GK + S  K  + LD  E+ + K+  E   + FE + K IK+VL                P C+V  +YG + +M+++M+        M G M  K  +E+N E+ ++++L+  AD +
Sbjct:  378 SFGQVLKEGVSDDYSNKEKIAGLLRFATTESGDAKQTVSLADYVSRMKEGQDTIYYITSDSYKAAVNNPQLEAFKKKGIEVILMTDRIDEWMMSTLTEFDGKHMKSIIKGDIDLDKFETPENKEKFEKEAKDFEKVLKEIKEVLKDKVEDVRLSKRLTDSPSCVVVNDYGMSLHMQKMMEEAG--QGFMPG-MGMKPILELNAEHNLVQKLKNEADTE 592          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEPA (Chaperone protein htpG OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=htpG PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.937e-35
Identity = 89/215 (41.40%), Postives = 121/215 (56.28%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESE--DEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  NK ++A LLR+ ST +G+     SL DY+ RM+EGQ+ IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L EF+GKKL S T+  L+L E E  DEK+ +E L+ + EGL K +KD LG               P C+V GE   +  M ++M+A              K T E+NPE+P++  L    D
Sbjct:  388 FGQVLKEGPAEDFANKERIAGLLRFASTHTGEATPNVSLADYIERMQEGQSKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEFDGKKLHSVTRGDLELGELEDDDEKEAQEKLQTESEGLVKRVKDSLGDKVSEVKVTTRLTDTPACVVAGEGEMSTQMIKLMQAAG------QDVPEPKPTFELNPEHPLVARLNDEQD 596          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PELPD (Chaperone protein htpG OS=Pelobacter propionicus (strain DSM 2379) GN=htpG PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.937e-35
Identity = 93/228 (40.79%), Postives = 128/228 (56.14%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKS-GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKE----KFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKA--QALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F   LK G+H D  NK KL EL  + ST +     TSLK+YV RM E Q +IY+ITG+S+  ++ SP LE  K KGYEVL++ D +DE+ V  L E++ KKL +  +  + LD SE+EKK KET +E    ++  L   IK  L                 CCLV  EYG  ANMERI+KA  Q + D        SK+ +E+NP++PIM+ + +    +K D  + D
Sbjct:  390 FGPVLKEGLHFDYANKEKLQELALFESTATEAGSFTSLKEYVERMPEAQQEIYFITGDSRATLKISPHLEAFKAKGYEVLFLTDPVDEWVVQALTEYKEKKLKAVDRGDVDLD-SEEEKKEKETKQEEARKEYGDLISFIKSHLEDRVKDARLSKRLTDSACCLVADEYGINANMERILKAMNQPVPD--------SKRVLELNPDHPIMKIMTEIFRENKEDARLTD 608          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BORA1 (Chaperone protein htpG OS=Bordetella avium (strain 197N) GN=htpG PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.937e-35
Identity = 84/217 (38.71%), Postives = 128/217 (58.99%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F + LK G+ ED +N+ ++A+LLR+ ST +GD  + TSL+DY+ R+KEGQ+ IYY+T +S  A  NSP LE  +KKG EVL + D +DE+ +  L+EFEGK LVS  K GL L +   E+EKK +  + E F+ L + ++  LG               P C+V G+   + ++ R++KA       +      K  +EINPE+ ++  +R  +DAD
Sbjct:  383 FGQVLKEGVGEDPSNQERIAKLLRFASTHAGDASQTTSLQDYLGRLKEGQDKIYYVTADSYSAASNSPHLEIFRKKGIEVLLLWDRVDEWMLSHLREFEGKSLVSVAKGGLDLADLADEEEKKKQTEVAESFKPLIERLQTALGEQVKEVRVTLRLVDSPACVVVGQNDLSPHLLRMLKAAGQEVPEV------KPVLEINPEHALIARIRDVSDAD 593          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_CHRVO (Chaperone protein htpG OS=Chromobacterium violaceum GN=htpG PE=3 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 5.142e-35
Identity = 86/215 (40.00%), Postives = 125/215 (58.14%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDE--LTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE--KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G+ ED  NK ++A+LLR+ ST S D     SL DY+ RMKEGQ+ IYYIT ++  A +NSP LE  KKKG EVL + D +DE+  G L EF+GK L S  K  L L   EDE  K+ ++ ++E  + + + ++  LG               P CLV GE+  +A++ER++KA   +         SK T+EINPE+ +++ L + +D
Sbjct:  381 FGQVLKEGVGEDFANKERIAKLLRFVSTASEDAEPTVSLADYIGRMKEGQDKIYYITADTLAAAKNSPHLEVFKKKGVEVLLLTDRVDEWVTGSLFEFDGKALQSVAKGALDLGALEDEADKEAQKQVEEASKPVVEKVQKALGDKVKEVRATARLVESPACLVAGEHDMSAHLERMLKAAGQK------IEGSKPTLEINPEHVLVKRLAEESD 589          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_FRATT2.308e-3538.99Chaperone protein htpG OS=Francisella tularensis s... [more]
HTPG_FRAT12.308e-3538.99Chaperone protein htpG OS=Francisella tularensis s... [more]
HTPG_SHELP3.014e-3541.01Chaperone protein htpG OS=Shewanella loihica (stra... [more]
HTPG_SHEDO3.014e-3541.40Chaperone protein htpG OS=Shewanella denitrificans... [more]
HTPG_FRATN3.014e-3539.45Chaperone protein htpG OS=Francisella tularensis s... [more]
HTPG_FRAP23.014e-3539.91Chaperone protein htpG OS=Francisella philomiragia... [more]
HTPG_SHEPA3.937e-3541.40Chaperone protein htpG OS=Shewanella pealeana (str... [more]
HTPG_PELPD3.937e-3540.79Chaperone protein htpG OS=Pelobacter propionicus (... [more]
HTPG_BORA13.937e-3538.71Chaperone protein htpG OS=Bordetella avium (strain... [more]
HTPG_CHRVO5.142e-3540.00Chaperone protein htpG OS=Chromobacterium violaceu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top