FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HS904_HUMAN (Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens GN=HSP90AA4P PE=5 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.142e-35
Identity = 83/170 (48.82%), Postives = 106/170 (62.35%), Query Frame = 2
Query:  173 ESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKE-----TLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            E+K  V NS  +++L K G EV+Y ++ IDEY V QLKEFEGK LVS TKE L+L E E+EKK +E     T ++K + L    K                           YGWTANMERIMKAQALRDNS  GYM++KK +EINP++  ++ LR++A+ DKNDKSVKD
Sbjct:  205 ETKDQVANSTIVQRLWKHGLEVIYTIEPIDEYCVQQLKEFEGKTLVSVTKEDLELPEDEEEKKKQEEGKQKTKQKKNQSLRTSAKST-------------------------YGWTANMERIMKAQALRDNSTTGYMAAKKHLEINPDHSFIDTLRQKAETDKNDKSVKD 349          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHESH (Chaperone protein htpG OS=Shewanella sediminis (strain HAW-EB3) GN=htpG PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.145e-34
Identity = 89/215 (41.40%), Postives = 122/215 (56.74%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  NK ++A LLR+ ST + D     SL DYV+RM+EGQ+ IYYI  +S +A  NSP LE L+KKG EV+ M + IDE+ +  L +F+GK+L S T+  L+L + ED  EK+ +E L+ + EGL K IKD LG               P C+V GE   +  M ++M+A             SK T EINPE+P++  L    D
Sbjct:  388 FGQVLKEGPAEDMVNKERIAGLLRFASTHTEDAAPTVSLADYVSRMQEGQSKIYYIVADSHEAAANSPHLELLRKKGIEVVLMSERIDEWLINHLTDFDGKQLHSVTRGDLELGDLEDAGEKEAQEKLETESEGLVKRIKDSLGEKVSAVKVTTRLTDTPACVVAGEGEMSTQMIKLMEAAG------QAVPESKPTFEINPEHPLVARLNDEQD 596          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_GEOSL (Chaperone protein htpG OS=Geobacter sulfurreducens GN=htpG PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.496e-34
Identity = 87/226 (38.50%), Postives = 124/226 (54.87%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKS-GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKE----KFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F   LK G+H D  N+ KL +LL + ST +      SLK+YV RM EGQ +IY+ITG S+ A+E SP LE  +KKGYEVL++ D +DE+ V  L E+ GKKL  A   G  +  +E+EKK +E  +E    ++  L   +K+ L                 CCLV  E+G  ANMERI++A             SK+ +E+NP++PIM+ +      DK +  + D
Sbjct:  391 FGPVLKEGVHFDYANRDKLQDLLLFESTATDAGSFVSLKEYVERMPEGQEEIYFITGTSRAALEQSPHLEIFRKKGYEVLFLTDPVDEWVVQGLPEYGGKKL-KAVDRGDVIPATEEEKKEQEAKREEAAKQYGDLLSFVKEKLAERVKEVRLSNRLTDSACCLVADEHGLNANMERILRAM------NQTVPESKRILELNPDHPIMQVMATLFGKDKTNPRLAD 609          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: ENPLL_HUMAN (Putative endoplasmin-like protein OS=Homo sapiens GN=HSP90B2P PE=5 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.954e-34
Identity = 84/225 (37.33%), Postives = 125/225 (55.56%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKD-VLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDN---SMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F  N+KLG+ ED +N+T LA+LLR+ S+    ++TSL   V RMKE Q+ I  + G                  GYEV+Y+ + + EY +  L EF+GK+  +  KEG+K D+SE  K+  E ++++FE L   +KD  +                 C LV  +YGW+ NMERIMKAQA +     S   + S KKT EINP +P++ ++ +R   D++DK+V D
Sbjct:  145 FGTNIKLGVIEDHSNRTCLAKLLRFQSSHHPADITSLHQDVERMKEKQDKICLMAG------------------GYEVIYLTEPVVEYCIQALPEFDGKRFQNVAKEGVKFDDSEKTKESHEAVEKEFEPLPNWVKDKAIKDKIEKAMVSQCLTESLCALVASQYGWSGNMERIMKAQAYQTGKGISTNYHASRKKTFEINPRHPLIRDMLRRIKEDEDDKTVLD 351          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ALHEH (Chaperone protein htpG OS=Alkalilimnicola ehrlichei (strain MLHE-1) GN=htpG PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.552e-34
Identity = 92/246 (37.40%), Postives = 126/246 (51.22%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYM--SSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +F K LK G+ ED  N+ ++A+LLR+ +T+  +E    SL DY+ RMKEGQ  IYY+T ES  A  NSP LE  +KKG EVL + D +DE+ +  L E++GK L S  K GL L E ED  EKK  E   E  + L + +K  L                P CLV GEY +   M+R++KA        AG+     K  +EIN ++PI++    R D   +D    D           T G  L+
Sbjct:  389 NFGKVLKEGVAEDFANRERIAKLLRFSTTQDENETPDVSLDDYIARMKEGQEAIYYVTAESFNAARNSPHLEVFRKKGVEVLLLPDPVDEWVITHLNEYDGKPLKSVAKGGLDLGELEDQAEKKAAEEATESHKDLLEKLKGALEDKVSEVRVSTRLTDSPACLVVGEYDFGMGMQRLLKA--------AGHAMPQGKPALEINIDHPIVQ----RMDTGLDDARFSDWAAVLYDQALLTEGGQLE 622          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_METFK (Chaperone protein htpG OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=htpG1 PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.425e-34
Identity = 85/218 (38.99%), Postives = 125/218 (57.34%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSG--DELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F + LK G  ED  NK ++A LLR+ ST +   +++ S KDY+ RMKEGQ  IYYIT +S  A ++SP LE  +KKG EVL + D +DE+ V  L EF+GKKL S  K  L L + ED  EK+ ++  +++++ L + I+  LG               P CLV GE+  + N+ER++KA   +         SK  +EINP++ I++ L+   D  K
Sbjct:  382 FGRVLKEGPGEDFANKERIAGLLRFASTHADTDEQVVSFKDYIARMKEGQEAIYYITADSFAAAKHSPHLEIFRKKGIEVLLLSDRVDEWLVSSLTEFDGKKLQSVAKGDLDLGKLEDEAEKEQQKKTEDEYKPLVERIQAALGDSVKEVRVTHRLTDSPACLVAGEHDLSGNLERLLKAAGQKT------PGSKPILEINPDHGIVQRLKDVTDEAK 593          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_FRATH (Chaperone protein htpG OS=Francisella tularensis subsp. holarctica (strain LVS) GN=htpG PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.425e-34
Identity = 83/218 (38.07%), Postives = 126/218 (57.80%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            SF + LK G+ +D +NK K+A LLR+ +T+SGD  +  SL DY++RMKE Q+ IYYIT +S KA  N+P LE  KKKG EV+ M D IDE+ +  L EF+ K + S  K  + LD  E+ + K+  E   + FE + K IK+VL                P C+V  +YG + +M+++M+       S    M  K  +E+N E+ ++++L+  AD +
Sbjct:  378 SFGQVLKEGVSDDYSNKEKIAGLLRFATTQSGDSKQTVSLADYISRMKESQDTIYYITSDSYKAAANNPQLEAFKKKGIEVILMTDRIDEWMMSTLTEFDDKHMKSIIKGDIDLDKFETPENKEKFEKEAKDFEKVLKEIKEVLKDKVEDVRLSKRLTDSPSCVVVNDYGMSLHMQKMMEEAG---QSFMPGMGMKPILELNAEHNLVQKLKNEADTE 592          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_FRATF (Chaperone protein htpG OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=htpG PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.425e-34
Identity = 83/218 (38.07%), Postives = 126/218 (57.80%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD--ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            SF + LK G+ +D +NK K+A LLR+ +T+SGD  +  SL DY++RMKE Q+ IYYIT +S KA  N+P LE  KKKG EV+ M D IDE+ +  L EF+ K + S  K  + LD  E+ + K+  E   + FE + K IK+VL                P C+V  +YG + +M+++M+       S    M  K  +E+N E+ ++++L+  AD +
Sbjct:  378 SFGQVLKEGVSDDYSNKEKIAGLLRFATTQSGDSKQTVSLADYISRMKESQDTIYYITSDSYKAAANNPQLEAFKKKGIEVILMTDRIDEWMMSTLTEFDDKHMKSIIKGDIDLDKFETPENKEKFEKEAKDFEKVLKEIKEVLKDKVEDVRLSKRLTDSPSCVVVNDYGMSLHMQKMMEEAG---QSFMPGMGMKPILELNAEHNLVQKLKNEADTE 592          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_GEOMG (Chaperone protein htpG OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=htpG PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 9.697e-34
Identity = 84/226 (37.17%), Postives = 127/226 (56.19%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKS-GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKE----KFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKD 667
            F + LK G+H D  N+ KL +LL + ST++   + TSLK+YV RM  GQ +IY+ITG S+ A+E SP LE  +KK YEVL++ D +DE+ V  + E++GKKL  A   G  +  +E+EKK +E  +E    ++  L   +K+ L                 CCLV  E+G  ANMERI++A             SK+ +E+NP++P+M+ +      DK +  + D
Sbjct:  391 FGQVLKEGVHFDYANREKLQDLLLFESTRTEAGKFTSLKEYVERMPAGQEEIYFITGTSRTALEQSPHLEIFRKKEYEVLFLTDPVDEWVVQGVTEYDGKKL-KAVDRGDVIPATEEEKKEQEAKREEAFKQYGDLLSFVKEKLDARVKEVRLSSRLTDSACCLVADEHGLNANMERILRAM------NQDVPESKRILELNPDHPLMQVMANLFARDKANPRLGD 609          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_MARMS (Chaperone protein htpG OS=Marinomonas sp. (strain MWYL1) GN=htpG PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.160e-33
Identity = 85/218 (38.99%), Postives = 118/218 (54.13%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKS--GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL--DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   +K G  +D  NK K+A LLR+ ST +    +  SL DY+ RM+EGQ+ IYYI  ES    +NSP LE L+KKG+EVL + D IDE+ +  L+EFEGK     TK  L L   E+E+EKK KE   EK + L   +K VL                P CLV GEY     M R+++    +         SK T+E+NP++PI+ ++    D ++
Sbjct:  392 FGNVIKEGPADDMGNKDKIAGLLRFSSTHTDAAAQTVSLADYIERMQEGQDKIYYIYAESHNTAKNSPHLEILRKKGFEVLLLSDRIDEWMMSSLQEFEGKSFQDVTKGKLDLADQENEEEKKEKEEKAEKMKPLLDRMKAVLNEKVAGVNSTDRLTNSPACLVVGEYDMGLQMRRLLEQAGQK------LPESKPTLEVNPDHPIVAKMDSETDEER 603          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HS904_HUMAN5.142e-3548.82Putative heat shock protein HSP 90-alpha A4 OS=Hom... [more]
HTPG_SHESH1.145e-3441.40Chaperone protein htpG OS=Shewanella sediminis (st... [more]
HTPG_GEOSL1.496e-3438.50Chaperone protein htpG OS=Geobacter sulfurreducens... [more]
ENPLL_HUMAN1.954e-3437.33Putative endoplasmin-like protein OS=Homo sapiens ... [more]
HTPG_ALHEH2.552e-3437.40Chaperone protein htpG OS=Alkalilimnicola ehrliche... [more]
HTPG_METFK7.425e-3438.99Chaperone protein htpG OS=Methylobacillus flagella... [more]
HTPG_FRATH7.425e-3438.07Chaperone protein htpG OS=Francisella tularensis s... [more]
HTPG_FRATF7.425e-3438.07Chaperone protein htpG OS=Francisella tularensis s... [more]
HTPG_GEOMG9.697e-3437.17Chaperone protein htpG OS=Geobacter metallireducen... [more]
HTPG_MARMS2.160e-3338.99Chaperone protein htpG OS=Marinomonas sp. (strain ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top