FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BV_ARATH (Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.484e-23
Identity = 56/186 (30.11%), Postives = 105/186 (56.45%), Query Frame = 3
Query:   81 WLL-FSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSID 635
            WLL   +++ + +  F+   +   +R PP P   P+IGNL +LG+ PH+SL KL+K +GP+M LK G+V TV+ SS+  AK+ L+  D   C+R          ++   + + P    W+ +RK+     FSS+Q+ + Q ++ ++++ L+  + E+    T I++ +     T++++  T FS++
Sbjct:    5 WLLSLIFVICILVAVFNHKNRRNYQRTPPSPPGCPIIGNLHQLGELPHQSLWKLSKKYGPVMLLKLGRVPTVIVSSSETAKQALKIHDLHCCSRPGFAGARELSYNYLDIAFSPYDDYWKEVRKLAVQELFSSKQVHSIQPIKDEEVKKLIDSISESAAQKTPINLNKTLLALTVSVVCRTAFSVN 190          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BY_ARATH (Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=2 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 4.551e-23
Identity = 59/186 (31.72%), Postives = 100/186 (53.76%), Query Frame = 3
Query:   75 VPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSI 632
            +P L  S +L+ AL    R      +R PP P  +P+IGNL +LG+ PH+SL  L+K +GP+M LKFG + TVV SS+  AK+ L+  D + C+R       A  ++   + + P    W+ LR++C    FS +Q+   Q +R ++++ L+    E+    T +++ +     T+ +I    F +
Sbjct:    7 LPLLFLSCLLLAALRLKKR---RQHQRKPPSPPGFPIIGNLHQLGELPHQSLWSLSKKYGPVMLLKFGSIPTVVVSSSETAKQALKIHDLNCCSRPSLAGPRALSYNYLDIVFSPFNDYWKELRRMCVQELFSPKQVHLIQPIREEEVKKLMNSFSESAAQKTPVNLSEKLASLTVGVICKAAFGV 189          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BB_ARATH (Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.943e-23
Identity = 58/189 (30.69%), Postives = 105/189 (55.56%), Query Frame = 3
Query:   96 WILVVALNYFS-----RGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL 638
            W ++VA  +FS     R  +   + LPPGP   P+IGNL +LG KPH S+ KL++ +GP+M+L+FG V+TVV S+    KE+L+  D   C+R   T P A   +   + G  + P    WR +RK+     ++++++ + QH R++++  L+ ++ +       +++       + ++I   +F I+L
Sbjct:    4 WYIIVAFVFFSTIIIVRNTRKTKKNLPPGPPRLPIIGNLHQLGSKPHSSMFKLSEKYGPLMALRFGSVSTVVASTPETVKEVLKTFDAECCSRPYMTYP-ARLTYNLKDIG--FCPYTKYWREVRKMTVVELYTAKRVQSFQHTRKEEVASLVDFITQAASLEKPVNLNTKLMKLSGSVICRVVFGINL 189          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BX_ARATH (Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.324e-22
Identity = 57/184 (30.98%), Postives = 100/184 (54.35%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSID 635
            L  S IL+ A  +  R      +R PP P  +P+IGNL +LG+ PH+SL +L+K +G +M LKFG + TVV SS+  AK++L+  D   C+R       A  ++   + + P    W+ LR+IC    FS +++ + Q ++  +++ L+  V E+   GT +++ +     T+ +     F ++
Sbjct:   10 LFLSCILLAAFTHKKR---QQHQRKPPSPPGFPIIGNLHQLGELPHQSLWRLSKKYGHVMLLKFGSIPTVVVSSSETAKQVLKIHDLHCCSRPSLAGPRALSYNYLDIAFSPFDDYWKELRRICVQELFSVKRVQSFQPIKEDEVKKLIDSVSESASQGTPVNLSEKFTSLTVRVTCKATFGVN 190          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71B9_ARATH (Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3)

HSP 1 Score: 106.686 bits (265), Expect = 1.324e-22
Identity = 53/185 (28.65%), Postives = 102/185 (55.14%), Query Frame = 3
Query:   81 WLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSID 635
            +L   ++  + L  F    +  +++ PP P  +P+IGNL +LG+ PH+SL  L+K +GP+M LK G V TVV SS+  AK++L+  D   C+R          ++   + + P    W+ LR+IC    FS++++ + Q ++ ++++ L+    E+    + +++ +     T+++I    FS+D
Sbjct:    6 FLSLLFLCCILLAAFKHKKRRTNQQQPPSPPGFPIIGNLHQLGELPHQSLWSLSKTYGPVMLLKLGSVPTVVVSSSETAKQVLKINDLHCCSRPSLAGAKELSYNYLDIAFSPFDDYWKELRRICVQELFSAKRVHSIQPIKEEEVRKLIVSATESASQKSPVNLSEKFLDLTVSVICKAAFSLD 190          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.729e-22
Identity = 66/204 (32.35%), Postives = 113/204 (55.39%), Query Frame = 3
Query:   84 LLFSWILVVALNYFS-RGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGT-AIHIGQAAFGTTLNLISNTIFSIDL--ADPTSKTAREFKQQI 683
            +L + +L + L  FS R  +S + RLPPGP P+P+IGNL  +G KPH++L+ +   +GPI+ L+ G V  VV +S ++A++ L+  D +F +R          ++   + + P    WR LRKI + H FS++ L+  +H+R++++  L    +E  R GT  +++GQ      +N +   +    L  AD   K A EF+  +
Sbjct:    8 ILLATVLFLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRTLSAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTL---TRELVRVGTKPVNLGQLVNMCVVNALGREMIGRRLFGADADHK-ADEFRSMV 207          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BA_ARATH (Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.258e-22
Identity = 55/193 (28.50%), Postives = 106/193 (54.92%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSID 635
            M ++  V  +L   IL+VA+ +  R +     R PP P   P+IGNL +LG+ PH+SL KL+K +GP+M LK G+V TV+ S+   AK++L++ D   C+R   +      ++   + +      W+ LRK+C    F ++++++ Q ++  +++ L+  + E+    T +++        +N+I   +F ++
Sbjct:    1 MTVLWFVSLILLISILLVAVKHSKRRWV----RQPPSPPGLPIIGNLHQLGELPHQSLCKLSKKYGPVMLLKLGRVPTVIVSTPETAKQVLKDYDLHCCSRPSLEGTRKLSYNYLDIAFSRFDDYWKELRKLCVEELFCNKRINSIQPIKEAEMEKLIDSIAESASQKTLVNLSDTFLSLNVNVICKAVFGVN 189          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BL_ARATH (Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 7.265e-21
Identity = 58/182 (31.87%), Postives = 99/182 (54.40%), Query Frame = 3
Query:   81 WLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            +L F  +L + L ++ R   S  + LPPGP   P+IGNL +LG   H+S  KL++ +GP+M L+FG V  VVFS+   A+E+L+  D   C R    A     ++   + +      WR +RK+     FSS++L A +++R ++ + L+  V E+ +  T + + +A F  T +++    F
Sbjct:    4 FLCFLLLLPLFLVFYKRLLPSKGK-LPPGPISLPIIGNLHQLGKSLHRSFYKLSQEYGPVMFLRFGVVPVVVFSTKEAAEEVLKTHDLETCTRPKLSATGLFTYNFKDIGFAQYGEDWREMRKLAMLELFSSKKLKAFRYIREEESELLVKKVTESAQTQTLVDLRKALFSYTASIVCRLAF 184          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71E1_SORBI (4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.239e-20
Identity = 60/186 (32.26%), Postives = 94/186 (50.54%), Query Frame = 3
Query:   75 VPWLLFSWILVVAL--NYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            +P LL S+ L+ +   N    G   G+ RLPPGP   P++GNL  LG  PHK+L +LA+ +GP+M L+ G V TVV SSA  A+E+L+  D   C+R          +    + + P    WR +RK+      S R++ A  + R +++  L+A +     +  +I +    F  T  +I    F
Sbjct:   26 LPVLLVSYYLLTSRSRNRSRSGKLGGAPRLPPGPAQLPILGNLHLLGPLPHKNLRELARRYGPVMQLRLGTVPTVVVSSAEAAREVLKVHDVDCCSRPASPGPKRLSYDLKNVGFAPYGEYWREMRKLFALELLSMRRVKAACYAREQEMDRLVADLDRAAASKASIVLNDHVFALTDGIIGTVAF 211          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AG_ARATH (Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.619e-20
Identity = 49/175 (28.00%), Postives = 99/175 (56.57%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQ 581
            M+M+  +   L +++ +  L +F    K  +  LPP P   PVIGNL +L   PH++L+ L+  HGP+M L+FG+V  ++ SSA +A ++++  D  F NR I  + +   +    + + P    WRN++ +C  H  S++ + +++  R ++I  L+  ++E   + +++++ +
Sbjct:    1 MEMMILISLCLTTFLTI--LLFFKSLLKRPNSNLPPSPWRLPVIGNLHQLSLHPHRALSSLSARHGPLMLLRFGRVPVLIVSSADVAHDVMKTHDLKFANRPITKSAHKISNGGRDLVFAPYGEYWRNVKSLCTIHLLSNKMVQSSEKRREEEITLLMETLEEASLSSSSVNLSK 173          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C71BV_ARATH3.484e-2330.11Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=C... [more]
C71BY_ARATH4.551e-2331.72Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=C... [more]
C71BB_ARATH5.943e-2330.69Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=C... [more]
C71BX_ARATH1.324e-2230.98Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=C... [more]
C71B9_ARATH1.324e-2228.65Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CY... [more]
F3PH_ARATH1.729e-2232.35Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C71BA_ARATH2.258e-2228.50Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=C... [more]
C71BL_ARATH7.265e-2131.87Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=C... [more]
C71E1_SORBI1.239e-2032.264-hydroxyphenylacetaldehyde oxime monooxygenase OS... [more]
C71AG_ARATH1.619e-2028.00Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top