FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BQ_ARATH (Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.114e-20
Identity = 58/216 (26.85%), Postives = 111/216 (51.39%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL------ADPTSKTAREFKQQIG 686
            MD +  +  L F  I+ + L  F R      RR+P  P  +P+IGNL +LG+  H+SL KL+K +GP+M LK G+V T++ SS+  AK+ L++ D   C+R          ++   M   P    W+ LRK+C+   FS+ ++ + Q ++ ++++ ++  + E+      +++ +     T +++    F +        +D  +K  R+  + +G
Sbjct:    1 MDSIWILSLLFF--IIFLLLAAFKRKNHGKHRRIP-SPPGFPIIGNLHQLGELQHQSLWKLSKKYGPVMLLKLGKVPTLILSSSETAKQALRDYDLHCCSRPSLAGGRELSYNNLDMSSSPYNEYWKELRKLCSQELFSANKIQSIQPIKDEEVKKVIDSIAESSSLKNPVNLSKTFLALTTSVVCKAAFGVSFEGSVLNSDRFNKLVRDTFEMLG 213          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BN_ARATH (Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.114e-20
Identity = 60/188 (31.91%), Postives = 100/188 (53.19%), Query Frame = 3
Query:   81 WLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL 638
            +LL   +L+V +  F+R  +S   +LPPGP   P+IGNL  L   PHK L  L KIHGP+M L+ G V  VV SS   A+E+L+  D   C+R  TI     ++   + G  + P    WR LRK+     FS ++ ++ +++R ++   L+  + E     + +++ +A F  + +++    F  +L
Sbjct:    7 FLLLLLLLLVTI-IFTRKSQSSKLKLPPGPPKLPIIGNLHYLNGLPHKCLLNLWKIHGPVMQLQLGYVPLVVISSNQAAEEVLKTHDLDCCSRPETIASKTISYNFKDIG--FAPYGEEWRALRKLAVIELFSLKKFNSFRYIREEENDLLVKKLSEASEKQSPVNLKKALFTLSASIVCRLAFGQNL 191          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71B1_THLAR (Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.114e-20
Identity = 52/194 (26.80%), Postives = 106/194 (54.64%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL 638
            MD++  V  L+    L++A     +  +   + LPPGP   P+IGNL +LG+KPH+++ +L+K +GP+MSLK G VTTVV +S    +++L+  D   C+R          ++   + + P    WR +RK+     ++++++ + +H+R +++   + + ++   +   +++ Q     + ++I    F I+L
Sbjct:    1 MDLLYIVAALVIFASLLIA-----KSKRKPKKNLPPGPPRLPIIGNLHQLGEKPHRAMVELSKTYGPLMSLKLGSVTTVVATSVETVRDVLKTYDLECCSRPYMTYPARITYNLKDLVFSPYDKYWRQVRKLTVVELYTAKRVQSFRHIREEEVASFVRFNKQAASSEETVNLSQKILKMSGSVICRIGFGINL 189          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BW_ARATH (Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.606e-20
Identity = 56/208 (26.92%), Postives = 105/208 (50.48%), Query Frame = 3
Query:   81 WLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL------ADPTSKTAREFKQQIG 686
            WLL    LV  L       K    R  P P  +P+IGNL ++G+ PH++L KL+K +GP+M L  G+V TVV SS+  A+++L+  D   C R          ++   + + P    W+ +RK+C    FS++Q+ + Q ++ ++++ ++  + E+      +++       T++++  T F +        +D  +K  RE  + +G
Sbjct:    5 WLLPLIFLVCILLAVFNHKKHPKYRQFPCPPGFPIIGNLHQIGELPHQTLWKLSKKYGPVMHLMLGRVPTVVVSSSDTARQVLRVHDLHCCTRPSLSGPRELSYNYLDIAFSPYDDYWKEVRKLCVQELFSTKQVHSIQPIKDEEVKKMIDSIAESASQKNPVNLNNKCLELTVSVVCRTAFGVSFEGTVLNSDRFNKIVREALEMLG 212          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71B4_ARATH (Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.370e-19
Identity = 57/194 (29.38%), Postives = 96/194 (49.48%), Query Frame = 3
Query:   63 MVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLAD 644
            MVS + + L   + +  L  F++  K   + LPPGP   P+IGNL +L    HK L  L+K HGP+M L+ G    VV SS+  A+E L+  D   C+R I  A      +   + +      WR LRK+     FS +++ + +++R ++   ++  ++E     + + + +  FG T ++I  T F     D
Sbjct:    1 MVSLLSFFLLLLVPIFFLLIFTKKIKESKQNLPPGPAKLPIIGNLHQLQGLLHKCLHDLSKKHGPVMHLRLGFAPMVVISSSEAAEEALKTHDLECCSRPITMASRVFSRNGKDIGFGVYGDEWRELRKLSVREFFSVKKVQSFKYIREEENDLMIKKLKELASKQSPVDLSKILFGLTASIIFRTAFGQSFFD 194          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.337e-19
Identity = 50/157 (31.85%), Postives = 94/157 (59.87%), Query Frame = 3
Query:  147 SRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEF-GMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAG-TAIHIGQAAFGTTLNLI 611
            + RLPPGP P+P+IGN  ++    H++L  LA+ +GPI+ L+FG V TVV SS+  AK  L+  D  F +R  P ++  +  + F  + + P    WR +RKIC     +S+++++ +H+R++++  ++  + E   +G  A+++ +A   +  N++
Sbjct:   39 NERLPPGPYPWPIIGNFHQVRLPLHRTLKNLAEKYGPILFLRFGSVPTVVVSSSEKAKHFLKTHDLIFASRP-PTSVGKYFFYNFKDIAFSPYGDHWRKMRKICVLELLTSKRIESFKHVRQEELSAMIHSIWEESESGRIAVNVSKAISTSLANIL 194          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BU_ARATH (Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.337e-19
Identity = 51/161 (31.68%), Postives = 88/161 (54.66%), Query Frame = 3
Query:  150 RRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            ++LPPGPT  P+IGNL +LG   H SL KL+  HGP+M +++G V   VFSS   AKE+L+  D   CNR   + + ++ HG+ + G  +      WR ++K      FS ++  + +++R ++   L+  +    +  T + + ++ F  T ++I    F
Sbjct:   26 KKLPPGPTGLPLIGNLHQLGRLLHSSLHKLSLEHGPVMLVRWGVVPMAVFSSNEAAKEVLKTHDLETCNRPKLVANGLFTHGYKDIG--FTQYGEEWREMKKFVGLELFSPKKHKSFRYIREEEGDLLVKKISNYAQTQTLVDLRKSLFSYTASIIFREAF 184          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BE_ARATH (Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.052e-19
Identity = 57/204 (27.94%), Postives = 112/204 (54.90%), Query Frame = 3
Query:   96 WILVVALNYF------SRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIY-AHGHHEFG-MPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            W  +V  ++F      ++  ++  + LPPGP   P+IGNL +LG KP +SL KL++ +G +MSLKFG V+ VV S+    K++L+  D   C+R  P   Y A   + F  + + P +  WR +RK+     ++++++ + Q++R++++   + +++++      +++ Q     + ++I    F I L    SK A  +++ I
Sbjct:    3 WWFIVGASFFFAFILIAKDTRTTKKNLPPGPPRLPIIGNLHQLGSKPQRSLFKLSEKYGSLMSLKFGNVSAVVASTPETVKDVLKTFDAECCSR--PYMTYPARVTYNFNDLAFSPYSKYWREVRKMTVIELYTAKRVKSFQNVRQEEVASFVDFIKQHASLEKTVNMKQKLVKLSGSVICKVGFGISL--EWSKLANTYEEVI 202          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C75A2_SOLME (Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.207e-19
Identity = 61/179 (34.08%), Postives = 88/179 (49.16%), Query Frame = 3
Query:  150 RRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH-GHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            RRLPPGP  +PVIG L  LG  PH +LAK+AK +GPIM LK G    VV S+   AK  L+  D +F NR  P+A   H  ++   M + P    W+ LRK+ N H    + L+   ++R  ++  +L  + +    G  I +         N+I   + S  +     K   EFK  +
Sbjct:   34 RRLPPGPEGWPVIGALPLLGGMPHVALAKMAKKYGPIMYLKVGTCGMVVASTPNAAKAFLKTLDINFSNRP-PNAGATHMAYNAQDMVFAPYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMFDASHVGERIVVADMLTFAMANMIGQVMLSKRVFVEKGKEVNEFKNMV 211          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BM_ARATH (Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.207e-19
Identity = 54/181 (29.83%), Postives = 94/181 (51.93%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            L F  +L + L +F +       +LPPGP   P+IGNL +LG   H+S  KL++ +GP+M L FG V  VV S+   A+E+L+  D   C R    A     ++   + +      WR +RK+     FSS++L A +++R ++ + L+  + ++    T + + +A F  T +++    F
Sbjct:    5 LYFLLLLPLFLIFFKK-LSPSKGKLPPGPLGLPIIGNLHQLGKSLHRSFHKLSQNYGPVMFLHFGVVPVVVVSTREAAEEVLKTHDLETCTRPKLTATKLFSYNYKDIGFAQYGDDWREMRKLAMLELFSSKKLKAFRYIREEESEVLVNKLSKSAETRTMVDLRKALFSYTASIVCRLAF 184          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C71BQ_ARATH2.114e-2026.85Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=C... [more]
C71BN_ARATH2.114e-2031.91Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=C... [more]
C71B1_THLAR2.114e-2026.80Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1... [more]
C71BW_ARATH3.606e-2026.92Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=C... [more]
C71B4_ARATH1.370e-1929.38Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CY... [more]
C75A1_PINTA2.337e-1931.85Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 P... [more]
C71BU_ARATH2.337e-1931.68Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=C... [more]
C71BE_ARATH3.052e-1927.94Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=C... [more]
C75A2_SOLME5.207e-1934.08Flavonoid 3',5'-hydroxylase OS=Solanum melongena G... [more]
C71BM_ARATH5.207e-1929.83Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top