FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C76A1_SOLME (Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.800e-19
Identity = 55/168 (32.74%), Postives = 89/168 (52.98%), Query Frame = 3
Query:  189 GNLLEL-GDKPHKSLAKLAKIHGPIMSLKFGQ-VTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRA----GTAIHIGQAAFGTTLNLISNTIFSIDL-ADPTSKTAREF 671
            GN+ +L G  P+K +A L + +GPI+ LK G  + T+V  +A  A E+ +N D SF +R I D   AH +++  M   P    WR  R+IC    F  ++++   ++R++ +  +L   +E   +    G  I + +  F  + N++ N IFS DL  DP SK   EF
Sbjct:    2 GNMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRPIVDVNLAHNYYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTNIRQESVDKMLRLDEEKASSSGGGGEGIEVTRYMFLASFNMVGNMIFSKDLVTDPESKQGSEF 169          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BD_ARATH (Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.515e-18
Identity = 46/186 (24.73%), Postives = 101/186 (54.30%), Query Frame = 3
Query:   96 WILVVALNYFSRGF-----KSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL 638
            W ++V   +F+  F     +   + LPPGP   P+IGNL +LG KPH+S+ KL++ +GP++ LK G+V +VV S+    K++L+  D   C+R          ++   + + P +  W+ +RK+     ++++++ + +++R +++   + +++ +      +++ Q     + ++I    F I+L
Sbjct:    4 WYIIVVFVFFASIFIAKNTRKTKKNLPPGPPRLPIIGNLHQLGSKPHRSMFKLSEKYGPLVYLKLGKVPSVVASTPETVKDVLKTFDKDCCSRAFLTYPARISYNLKDLAFAPYSKYWKAVRKMTVVELYTAKRVKSFRNIREEEVASFVEFIKHSASLEEIVNLNQTLVKLSGSVICRVGFGINL 189          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71A1_PERAE (Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.978e-18
Identity = 50/178 (28.09%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  102 LVVALNYFSRGFKSGSRR---LPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            L +AL +F         +   LPP P   P+IGNL +LG+ PH+SL  LA   GP++ L  G + T++ S+A +A+EIL+  D  F +R    A     +    + + P    WR +RKIC     S +++++ + +R +++  ++  + ++C  G A+++ +     +   I+   F
Sbjct:   10 LAIALTFFLLKLNEKREKKPNLPPSPPNLPIIGNLHQLGNLPHRSLRSLANELGPLILLHLGHIPTLIVSTAEIAEEILKTHDLIFASRPSTTAARRIFYDCTDVAFSPYGEYWRQVRKICVLELLSIKRVNSYRSIREEEVGLMMERISQSCSTGEAVNLSELLLLLSSGTITRVAF 187          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BJ_ARATH (Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.375e-18
Identity = 51/181 (28.18%), Postives = 94/181 (51.93%), Query Frame = 3
Query:   75 VPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLI 611
            + +L    I  V+L +F++  K     LPP P  +PVIGNL ++G+ PH+SL  LA+ +GP+M L FG V   V SS   A+E+L+  D   C+R   +   + +    + G  + P    W+  RK      F  +++ + +H+R ++   L+  + E+    + + + ++ F  T +++
Sbjct:    3 ISFLCVFLITFVSLIFFAKKIKRSKWNLPPSPPKFPVIGNLHQIGELPHRSLQHLAERYGPVMLLHFGFVPITVVSSREAAEEVLRTHDLDCCSRPKLVGTRLLSRDFKDIG--FTPYGNEWKARRKFALRELFCLKKVQSFRHIREEECNFLVKQLSESAVDRSPVDLSKSLFWLTASIL 181          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AO_ARATH (Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3)

HSP 1 Score: 92.0485 bits (227), Expect = 3.375e-18
Identity = 61/197 (30.96%), Postives = 102/197 (51.78%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL 638
            M M+  +  LL S IL+  L +F +  +      PP P   P+I NL +LG  PH+SL  L+  +GP+M L FG V  +V SSA  AK++L+  D  F +R    I D I+ +G     +   P    WR ++ +C  H FS++ + + + +R+++I  ++    E  R  +++ I  +     +NL +N I  + L
Sbjct:    1 MKMMMMIILLLCSIILITIL-FFKKQSRGKKSNAPPSPPRLPLIRNLHQLGRHPHRSLCSLSHRYGPLMLLHFGSVPVLVVSSADAAKDVLKTHDRVFASRPRSKIFDKIFYNGR---DVALAPYGEYWRQMKSVCVLHLFSNKMVRSFRDVRQEEISLMI----EKIRISSSLRINLSEI--LVNLTNNVICRVAL 187          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C75A7_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A7 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.408e-18
Identity = 56/182 (30.77%), Postives = 89/182 (48.90%), Query Frame = 3
Query:  141 SGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH-GHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            S   RLPPGP  +PV+G L  LG  PH +LA +AK +GP+M LK G     V S+   AK  L+  D +F NR  P+A   H  ++   M +      W+ LRK+ N H    + L   + +R+K++  +L  + E+ R G  + + +       N++   + S  +       + EFK  +
Sbjct:   32 SRRHRLPPGPIGWPVLGALRLLGTMPHVALANMAKKYGPVMYLKVGSCGLAVASTPEAAKAFLKTLDMNFSNRP-PNAGATHLAYNAQDMVFADYGPRWKLLRKLSNIHILGGKALQGWEEVRKKELGYMLYAMAESGRHGQPVVVSEMLTYAMANMLGQVMLSKRVFGSQGSESNEFKDMV 212          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71B5_ARATH (Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CYP71B5 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.408e-18
Identity = 56/192 (29.17%), Postives = 102/192 (53.12%), Query Frame = 3
Query:   81 WLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENC--RAGTAIHIGQAAFGTTLNLISNTIFSIDLAD 644
            +L F  +L ++L +  +   S  + LPPGP   P+IGNL + G   HKSL K+++ +GP+M L FG V  ++ SS   A+E+L+  D   C+R  T+   ++ +   + G  + P    WR +RKI  S  FS ++L + +++R  + Q L+  V ++      +++++ +  F    ++I    F  +  D
Sbjct:    4 FLCFLLLLPLSLIFLKKLLPSKGK-LPPGPKGLPIIGNLHQFGRFLHKSLHKISQEYGPVMLLHFGVVPVIIVSSKEGAEEVLKTHDLETCSRPKTVGSGLFTYNFKDIG--FAPYGENWREMRKIAVSELFSQKKLKSFRYIREDESQLLVRKVSKSALETPTSSVNLRKVIFTFAASIICRLSFGQNFCD 192          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C75A5_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A5 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.757e-18
Identity = 56/182 (30.77%), Postives = 89/182 (48.90%), Query Frame = 3
Query:  141 SGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH-GHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            S   RLPPGP  +PV+G L  LG  PH +LA +AK +GP+M LK G     V S+   AK  L+  D +F NR  P+A   H  ++   M +      W+ LRK+ N H    + L   + +R+K++  +L  + E+ R G  + + +       N++   + S  +       + EFK  +
Sbjct:   32 SRRHRLPPGPIGWPVLGALPLLGTMPHVALANMAKKYGPVMYLKVGSCGLAVASTPEAAKAFLKTLDMNFSNRP-PNAGATHLAYNAQDMVFADYGPRWKLLRKLSNIHILGGKALQGWEEVRKKELGYMLYAMAESGRHGQPVVVSEMLTYAMANMLGQVMLSKRVFGSQGSESNEFKDMV 212          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BK_ARATH (Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.518e-18
Identity = 50/178 (28.09%), Postives = 91/178 (51.12%), Query Frame = 3
Query:   75 VPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNL 608
            + +L F  I + +L +F++  K     LPP P  +PVIGNL ++G+ PH+SL  LA+ +GP+M L FG V   V SS   A+E+L+  D   C+R           +   + + P    W+  RK      F  +++ + +H+R ++   L+  + E+    + + + ++ F  T ++
Sbjct:    3 ISFLCFCLITLASLIFFAKKIKHLKWNLPPSPPKFPVIGNLHQIGELPHRSLQHLAERYGPVMLLHFGFVPVTVVSSREAAEEVLRTHDLDCCSRPKLVGTRLLSRNFKDVCFTPYGNEWKARRKFALRELFCLKKVQSFRHIREEECNFLVKQLSESAVNRSPVDLSKSLFWLTASI 180          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71DB_LOTJA (Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.819e-18
Identity = 49/160 (30.63%), Postives = 89/160 (55.62%), Query Frame = 3
Query:  156 LPPGPTPYPVIGNLLEL-GDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCN--RTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            +PPGP   P+IG++  L G  PH+ L  LAK +GP+M L+ G+V  ++ SSA  AKE+++  D +F +  R++   I  +G  + G  + P    WR +RKICN    S +++ +   +R +++++L+  +      G+ +++ QA       + S + F
Sbjct:   19 IPPGPWKLPIIGSIPHLVGSPPHRKLRDLAKKYGPLMHLQLGEVIFIIVSSAEYAKEVMKTHDVTFASRPRSLFTDIVFYGSTDIG--FSPYGDYWRQVRKICNVELLSMKRVQSLWPIREEEVKNLIQRIAS--EEGSVVNLSQAIDSLIFTITSRSAF 174          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C76A1_SOLME6.800e-1932.74Cytochrome P450 76A1 (Fragment) OS=Solanum melonge... [more]
C71BD_ARATH1.515e-1824.73Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=C... [more]
C71A1_PERAE1.978e-1828.09Cytochrome P450 71A1 OS=Persea americana GN=CYP71A... [more]
C71BJ_ARATH3.375e-1828.18Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=C... [more]
C71AO_ARATH3.375e-1830.96Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=C... [more]
C75A7_EUSGR4.408e-1830.77Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C71B5_ARATH4.408e-1829.17Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CY... [more]
C75A5_EUSGR5.757e-1830.77Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C71BK_ARATH7.518e-1828.09Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=C... [more]
C71DB_LOTJA9.819e-1830.63Cytochrome P450 71D11 (Fragment) OS=Lotus japonicu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top