FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C75A1_PETHY (Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.312e-17
Identity = 58/183 (31.69%), Postives = 87/183 (47.54%), Query Frame = 3
Query:  138 KSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH-GHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            K+  R LPPGP  +PVIG L  LG  PH SLAK+AK +G IM LK G     V S+   AK  L+  D +F NR  P+A   H  ++   M +      W+ LRK+ N H    + L+   ++R  ++  +L  + +  R G  + + +       N+I   + S  +         EFK  +
Sbjct:   27 KTTGRHLPPGPRGWPVIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCGMAVASTPDAAKAFLKTLDINFSNRP-PNAGATHLAYNAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMSDMSREGQRVVVAEMLTFAMANMIGQVMLSKRVFVDKGVEVNEFKDMV 208          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71D8_SOYBN (Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.312e-17
Identity = 51/185 (27.57%), Postives = 96/185 (51.89%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKS-GSRRLPPGPTPYPVIGNLLELG---DKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            ++ ++ + + L++  + +K   S +LPPGP   P+IGNL +L      P ++L KL + +GP+M L+ G+++T+V SS  MA E+++  D  F  R    A     +    + + P    WR +RKIC     S++++ +  H+R+ + + L+  +  +  AG+ I +    F      +S   F
Sbjct:    8 IVITFFVFLLLHWLVKTYKQKSSHKLPPGPWRLPIIGNLHQLALAASLPDQALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIHSS--AGSPIDLSGKLFSLLGTTVSRAAF 190          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71B6_ARATH (Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.312e-17
Identity = 46/167 (27.54%), Postives = 92/167 (55.09%), Query Frame = 3
Query:   75 VPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHI 575
            +PWLL   I  + + +  R  K+    LPPGP   P++GN+ +LG  PH+SL  L+  +GP++++  G V TVV  S   A+E+L+  D+  C R       +  +   G+ +      +R++RK+C    FS ++ ++ +++R +++  L+    ++  +G+++ +
Sbjct:   13 LPWLLLLLIPPLLIFFLLRSPKN----LPPGPPRLPILGNIHQLGSLPHRSLRDLSLKYGPVITVYLGSVRTVVVHSPETAEEVLKLHDSECCTRPKLSITKSFFYDGLGLGFTKWGDYYRDVRKLCVLELFSVKRANSFRNIREEELSRLVNSFSDSASSGSSVDL 175          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71A2_SOLME (Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.312e-17
Identity = 50/184 (27.17%), Postives = 95/184 (51.63%), Query Frame = 3
Query:   78 PWL-----LFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLIS 614
            PW      LF +I ++  + F    K  +  L P P   P+IGNL +LG  PH+SL KL++ +GP+M L FG    +V SS   A++I++  D  + +R     +    +    + + P    WR  + I   H  S+ ++ + +++R ++  +++  +++ C + + I++G+     T N+IS
Sbjct:    6 PWYSLLIPLFVFIFLLIHHCFFTTSKKQNMLLLPSPRKLPIIGNLHQLGSLPHRSLHKLSQKYGPVMLLHFGSKPVIVASSVDAARDIMKTHDVVWASRPKSSIVDRLSYGSKDVGFSPFGEYWRRAKSITVLHLLSNTRVQSYRNVRAEETANMIGKIRQGCDS-SVINLGEHLCSLTNNIIS 188          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71B7_ARATH (Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.086e-16
Identity = 48/182 (26.37%), Postives = 93/182 (51.10%), Query Frame = 3
Query:   99 ILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL 638
            + +V+L+  S+  K    +LPPGP   P+IGNL  L   PH     L++  GP+M L FG V  VV SS   A+E L+ QD   C+R  T+   + ++   + G  + P    W+ LRK+      ++++  + +++R ++   L+  + E+    + +++ +  F    +++    F +++
Sbjct:   13 VFLVSLSILSKRLKPSKWKLPPGPKTLPIIGNLHNLTGLPHTCFRNLSQKFGPVMLLHFGFVPVVVISSKEGAEEALKTQDLECCSRPETVATRMISYNFKDIG--FAPYGEEWKALRKLVVMELLNTKKFQSFRYIREEENDLLIKKLTESALKKSPVNLKKTLFTLVASIVCRLAFGVNI 192          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C83A1_ARATH (Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 1.418e-16
Identity = 56/183 (30.60%), Postives = 92/183 (50.27%), Query Frame = 3
Query:   99 ILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGD-KPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEF------GMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            +  V L +  +  K+   +LPPGP+P PVIGNLL+L    P +  A  AK +GPI+S + G  T VV SSA +AKE+L+ QD +F +R        H  HEF       M        +R +RK+  +H FS  ++   +H+R ++ + ++  + +       + I +     T +++    F
Sbjct:   11 LAAVLLFFLYQKPKTKRYKLPPGPSPLPVIGNLLQLQKLNPQRFFAGWAKKYGPILSYRIGSRTMVVISSAELAKELLKTQDVNFADRP------PHRGHEFISYGRRDMALNHYTPYYREIRKMGMNHLFSPTRVATFKHVREEEARRMMDKINKAADKSEVVDISELMLTFTNSVVCRQAF 187          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C99A1_SORBI (Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bicolor GN=CYP99A1 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.852e-16
Identity = 57/164 (34.76%), Postives = 86/164 (52.44%), Query Frame = 3
Query:   87 LFSWILVVALNYFSRGFKS--GSRRLPPGPTPYPVIGNLLELG-DKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAG 560
            L S +++   +  SR   S    ++ PPGP   P+IGNLL L   +PH +L  LA  HGP+M L+ GQV  VV SS A A+E+L+++DT+F +R    + D I    +    M + P    WR LRK+C S   ++ ++     +R  +   L+  V     AG
Sbjct:    2 LISAVILAVCSLISRRKPSPGSKKKRPPGPWRLPLIGNLLHLATSQPHVALRDLAMKHGPVMYLRLGQVDAVVISSPAAAQEVLRDKDTTFASRPSLLVADIIL---YGSMDMSFAPYGGNWRMLRKLCMSELLNTHKVRQLAAVRDSETLSLVRKVVYAAGAG 162          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71D7_SOLCH (Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.852e-16
Identity = 53/191 (27.75%), Postives = 98/191 (51.31%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLEL-GDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            M +VS   ++ F ++L     Y +    S +++LPPGP   P IG +  L G  PH+ L  LA+ +GP+M L+ G+V+ VV +S  MAK++L+  D +F +R    A+    ++   + + P    WR +RKIC     S++ + +   +R  ++  L+  +Q    +G  ++  +     T ++   + F
Sbjct:    1 MQLVSIFLFISFLFLLRKWKKYLNN---SQTKKLPPGPWKLPFIGGMHHLAGGLPHRVLRDLAEKYGPLMHLQLGEVSAVVVTSPEMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGDYWRQMRKICIMEVLSAKSVRSFSSIRHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAF 188          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BP_ARATH (Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.852e-16
Identity = 48/192 (25.00%), Postives = 97/192 (50.52%), Query Frame = 3
Query:   84 LLFSWILVVALNY-----FSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLAD 644
            +L S++L+++L +     +++  K   R LPPGP   P++GNL +L    H+ L +L+K HGP+M L+ G V  V+ SS+  A+E L+  D   C R   +A      +   +     +  WR LRK+     FS +++ + +++R ++   ++  +++     + + + +  F    + +   +F    +D
Sbjct:    3 ILQSFLLLLSLPFLFTLIYTKKMKESKRNLPPGPAKLPIVGNLHQLQGMVHRCLHELSKKHGPVMHLQLGFVPLVLISSSEAAEEALKTHDIECCTRPNTNAARVFSRNNKNIGLGAYSDEWRELRKVAVREYFSVKKVQSFRYVREEENHLMVKKLRDLALKQSPVDLSKTLFCLAASTVFRPVFGQSFSD 194          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71B3_ARATH (Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 1.852e-16
Identity = 50/181 (27.62%), Postives = 91/181 (50.28%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            L F ++ V+    F + FK   R LPP P   P+IGNL +L    H+ L  L+K HGP++ L+ G +  VV SS   A+E+L+  D   C R   +A          + + P   + R LRK+   + FS++++ + +++R ++   ++  ++E+ +    + + Q  F    ++I    F
Sbjct:    5 LYFFFLPVILSLIFMKKFKDSKRNLPPSPPKLPIIGNLHQLRGLFHRCLHDLSKKHGPVLLLRLGFIDMVVISSKEAAEEVLKVHDLECCTRPKTNASSKFSRDGKDIAFAPYGEVSRELRKLSLINFFSTQKVRSFRYIREEENDLMVKKLKESAKKKNTVDLSQTLFYLVGSIIFRATF 185          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C75A1_PETHY8.312e-1731.69Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida G... [more]
C71D8_SOYBN8.312e-1727.57Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=... [more]
C71B6_ARATH8.312e-1727.54Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CY... [more]
C71A2_SOLME8.312e-1727.17Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71... [more]
C71B7_ARATH1.086e-1626.37Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CY... [more]
C83A1_ARATH1.418e-1630.60Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CY... [more]
C99A1_SORBI1.852e-1634.76Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bico... [more]
C71D7_SOLCH1.852e-1627.75Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71... [more]
C71BP_ARATH1.852e-1625.00Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=C... [more]
C71B3_ARATH1.852e-1627.62Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CY... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top