FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.956e-14
Identity = 61/210 (29.05%), Postives = 97/210 (46.19%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSR--RLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTA-----------IHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFK 674
            LL S  L V L   S    +  R  RLPPGP P+PV+GNL ++     +   + A+ +GP++S+ FG   TVV S++ +AKE+L+  D    +R    +      +   + W      +  +RK+CN   F+ ++L+A   LR  +  ++ A V+   RA TA            H+   AF     L     F ++      +  REFK
Sbjct:    5 LLLSVALAVVLIPLSLALLNRLRLGRLPPGPRPWPVLGNLRQIKPIRCRCFQEWAERYGPVISVWFGSGLTVVVSTSELAKEVLKENDQQLADRPRNRSTQRFSRNGQDLIWADYGPHYIKVRKLCNLELFTPKRLEA---LRPIREDEVTAMVESVYRAATAPGNEGKPMVVRNHLSMVAFNNITRLAFGKRF-MNANGDIDEQGREFK 210          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C83B1_ARATH (Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.956e-14
Identity = 45/150 (30.00%), Postives = 80/150 (53.33%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGD-KPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLL 530
            L+ + ++  A  +F R     S RLPPGP   P+IGNL ++    P   L +L+K++GPI ++K G     V SSA +AKE+L+ QD +F  R +        +    + +      +R +RK+C  + FS  ++ + + +R ++ Q ++
Sbjct:    5 LIIAGLVAAAAFFFLRSTTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKLYGPIFTMKIGGRRLAVISSAELAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTAYYREMRKMCMVNLFSPNRVASFRPVREEECQRMM 154          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BO_ARATH (Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.861e-14
Identity = 51/181 (28.18%), Postives = 89/181 (49.17%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            +L  +I +++L    +  K  +R LPP P   PVIGNL +L    HK L  L+K HGP++ L+ G +  VV SS   A+E L+  D   C R I +           +   P     R LRK+     FS+ ++ + +++R ++   ++  ++E     +++ + Q  FG   ++I  + F
Sbjct:    3 ILLYFIALLSLIIIKK-IKDSNRNLPPSPLKLPVIGNLYQLRGLFHKCLHDLSKKHGPVLLLRLGFLDMVVISSTEAAEEALKVHDLECCTRPITNVTSKLWRDGQDIGLAPYGESLRELRKLSFLKFFSTTKVRSFRYIREEENDLMVKKLKEAALKKSSVDLSQTLFGLVGSIIFRSAF 182          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71A3_SOLME (Cytochrome P450 71A3 (Fragment) OS=Solanum melongena GN=CYP71A3 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.586e-14
Identity = 43/153 (28.10%), Postives = 81/153 (52.94%), Query Frame = 3
Query:   87 LFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQE 545
            LF +IL +   +F+    + +++LPP P   P+IGNL +LG  PH+SL KL+K +GP+M L  G    +V SS    ++I++  D  + NR          +    + + P    WR +R I   H  S++++ + +  R ++  +++  +++
Sbjct:    4 LFVFILFLHKCFFTTS--NNNKKLPPSPRKLPIIGNLHQLGLHPHRSLHKLSKKYGPVMLLHLGSKPVIVASSVEAVRDIMKTNDLVWSNRPKSKMADRLIYGSKDVSFSPHGEYWRQIRSITVLHLLSNKRVQSYRAAREEETSNMIEKLKQ 154          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71DF_MENPI (Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.602e-14
Identity = 52/188 (27.66%), Postives = 95/188 (50.53%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNL-LELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLAD 644
            L+ ++ + + +N + +    G  + PPGP   P+IG+L L  G  P  +LA +AK +GP+  ++ G+V +VV SS    KE ++  D +  NR          +    + + P +  WR +RKIC S   SSR + +   +R+ ++  LL +++ +  AG A+ + +     T ++I    F   + D
Sbjct:   13 LVVTYTISLLINQWRKPKPQG--KFPPGPPKLPLIGHLHLLWGKLPQHALASVAKEYGPVAHVQLGEVFSVVLSSREATKEAMKLVDPACANRFESIGTRIMWYDNEDIIFSPYSEHWRQMRKICVSELLSSRNVRSFGFIRQDEVSRLLRHLRSS--AGAAVDMTERIETLTCSIICRAAFGSVIRD 196          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BS_ARATH (Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.602e-14
Identity = 48/188 (25.53%), Postives = 95/188 (50.53%), Query Frame = 3
Query:   81 WLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLAD 644
            +L F  +L + L  F +  K    +LPPGP   P+IGNL +  +   ++   L++ +GPI+ L++G V  VV SS   A+E+L+  D   C+R       A  ++   + + P    WR +RK+     FSS++L + +++R ++    +  + +     + +++ +  F    +++    F I+L +
Sbjct:    4 FLCFLCLLPLIL-IFLKNLKPSKWKLPPGPKKLPIIGNLHQRRELHPRNSRNLSEKYGPIVFLRYGFVPVVVISSKEAAEEVLKTHDLECCSRPETVGTRAISYNFKDIGFAPYGEDWRTMRKLSVVELFSSKKLQSFRYIREEENDLCVKKLSDLASRRSLVNLEKTLFTLVGSIVCRIGFGINLRE 190          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AR_ARATH (Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=2 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 1.123e-13
Identity = 41/153 (26.80%), Postives = 82/153 (53.59%), Query Frame = 3
Query:  153 RLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLI 611
            +LPP P   PVIGNL +LG  PH+ L  L+  +GP+M L FG+V  +V S   +  +I++  D  F NR    AI         + + P    W++++ +   H  +++ + + ++LR ++I+ +   ++E   + +++++ +     T ++I
Sbjct:   32 KLPPSPWRLPVIGNLHQLGPNPHRYLHSLSLRYGPLMLLHFGRVPVLVVSCPDVTNDIMKTHDLKFANRPKSKAINIFMEGGRDIIFGPYGEDWKSMKSLGVVHLLNNKMVRSFENLREEEIKVMTEKLEEASSSSSSVNLSKLLMTLTNDII 184          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71D9_SOYBN (Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.916e-13
Identity = 46/157 (29.30%), Postives = 77/157 (49.04%), Query Frame = 3
Query:  156 LPPGPTPYPVIGNLLEL--GDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNT 620
            LPPGP   P+IGN+  L     PH  L  L+  +G +M LK G+V+T+V SS   AKE+++  D  F +R    A     +   G+ + P    WR LRKI      SS+++ + Q +R + +   +  +      G+ +++ +    T   + + T
Sbjct:   35 LPPGPWKLPIIGNMHNLVGSPLPHHRLRDLSAKYGSLMHLKLGEVSTIVVSSPEYAKEVMKTHDHIFASRPYVLAAEIMDYDFKGVAFTPYGDYWRQLRKIFALELLSSKRVQSFQPIREEVLTSFIKRMA--TIEGSQVNVTKEVISTVFTITART 189          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AF_ARATH (Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.916e-13
Identity = 45/176 (25.57%), Postives = 87/176 (49.43%), Query Frame = 3
Query:  156 LPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            LPP P   PVIGNL +L   PH+SL  L+  +GP+M L FG+V  +V SS+ +A ++++  D    NR     I    +    + + P    WR ++ +C  H  + + + +   +R ++   ++  V++     + +++ +     T ++ S   F    ++  S +  +FK Q+
Sbjct:   32 LPPSPWRVPVIGNLHQLSLHPHRSLRSLSHRYGPLMLLHFGRVPILVVSSSDVAHDLMKTHDLKVANRPRLKVIETILNGGREVVFSPYGDYWRQIKTVCVVHLLNKKMVQSFAKVREEERSVMMEKVEKASSDSSPLNLSKLLITLTSDVASRVSFGKKHSNEASMS--DFKNQV 205          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BG_ARATH (Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.576e-13
Identity = 47/184 (25.54%), Postives = 85/184 (46.20%), Query Frame = 3
Query:   99 ILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLAD 644
            I +V+L +  +  K     LPP P  +PVIGNL ++G+ PH+S  +LA+  G +M L FG V   V SS   A+E+L+  D   C R   +   + + G  +  + + P    WR  RK      F  +++    ++  ++   L+  + E+      + + ++ F    +++    F     D
Sbjct:   11 ITLVSLIFVVKKIKHSKWDLPPSPPTFPVIGNLHQVGELPHRSFQRLAERTGHVMLLHFGFVPVTVISSREAAEEVLRTHDLKCCTRPKLVGSRLISRGFKD--ISFTPYGEEWRERRKFLVRELFCFKKVQYFGYIVEEECNLLVKKLTESAVGRPPVDLSKSLFWLAASILFRIAFGQSFHD 192          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C98A1_SORBI2.956e-1429.05Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]
C83B1_ARATH2.956e-1430.00Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CY... [more]
C71BO_ARATH3.861e-1428.18Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=C... [more]
C71A3_SOLME6.586e-1428.10Cytochrome P450 71A3 (Fragment) OS=Solanum melonge... [more]
C71DF_MENPI8.602e-1427.66Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D... [more]
C71BS_ARATH8.602e-1425.53Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=C... [more]
C71AR_ARATH1.123e-1326.80Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=C... [more]
C71D9_SOYBN1.916e-1329.30Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=... [more]
C71AF_ARATH1.916e-1325.57Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=C... [more]
C71BG_ARATH5.576e-1325.54Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top