FC931322

Overview
NameFC931322
Unique NameFC931322
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig309 contig Ccv1_Contig309:20..740. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_METTH (30S ribosomal protein S13P OS=Methanobacterium thermoautotrophicum GN=rps13p PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.363e-26
Identity = 52/128 (40.62%), Postives = 86/128 (67.19%), Query Frame = 1
Query:  103 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            E+F+H++R+   ++DG + +  ALTSIKG+G+ L+  +   A  D+N+R G LS  E++ L   + NP ++ IP W +NR+ DY+ G+   ++ + L+M LR+DL R++K R+++G RH  GL VRGQ
Sbjct:    3 EEFKHMVRIARKDIDGNKTMENALTSIKGVGKALSRAIIMSAGYDLNQRIGYLSDEEIERLEEAIKNPAKYNIPSWMINRRNDYETGEDKHLIESDLEMCLREDLNRMRKTRSYKGRRHELGLPVRGQ 130          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_METS3 (30S ribosomal protein S13P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps13p PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.698e-26
Identity = 53/128 (41.41%), Postives = 87/128 (67.97%), Query Frame = 1
Query:  103 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            +DF+H++R+   +VDG + I  ALT IKG+G  L+  +C+  D+D   + G ++  ++  +  ++ NP++F IP+W LNR++DY+ G+   ++ + LDM LRDDL R+KK R+++G RH  GL VRGQ
Sbjct:    3 DDFKHLVRISRKDVDGNKTIEQALTEIKGVGISLSTTMCRTLDLDSEAQIGYIADEDVLKIEEILENPQKFNIPNWMLNRREDYETGENIHLIESDLDMTLRDDLNRMKKTRSYKGRRHEAGLPVRGQ 130          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_PYRHO (30S ribosomal protein S13P OS=Pyrococcus horikoshii GN=rps13p PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 6.300e-25
Identity = 56/145 (38.62%), Postives = 90/145 (62.07%), Query Frame = 1
Query:  106 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 540
            DF+HI+RV   ++DG +++ +ALT+IKG+G   A +VC+ A +D   +AG L+  ++  +  ++ +P    IP W +NR KDY+ GK   +++  LDM +R+D+ RL++IR +RG+RH  GL VRGQ              SKK+
Sbjct:    3 DFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILQDPVSHGIPRWAVNRPKDYETGKDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSKKK 147          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_METKA (30S ribosomal protein S13P OS=Methanopyrus kandleri GN=rps13p PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.394e-24
Identity = 54/133 (40.60%), Postives = 89/133 (66.92%), Query Frame = 1
Query:   94 VANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVA--NPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            +A+++ + I+R+ + ++DG +K+ +ALT IKGIG R+A  +C++  +D  K+ GELS  E++ +   +   +  +  IP W  NRQKDY+ G+   +V   L+M ++ D++RLKKIR +RG+RH  GL VRGQ
Sbjct:    1 MADDEVKPIVRIADVDLDGHKKVPYALTGIKGIGIRMAYAICRELGLDEEKKLGELSDEEIERIEEEIKKLSEGESNIPSWMYNRQKDYETGEDMHLVGAELEMTVKQDIDRLKKIRAYRGIRHELGLPVRGQ 133          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_PYRFU (30S ribosomal protein S13P OS=Pyrococcus furiosus GN=rps13p PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.127e-24
Identity = 53/127 (41.73%), Postives = 87/127 (68.50%), Query Frame = 1
Query:  106 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            +F+HI+RV   ++DG +++ +ALT+IKGIG   A +VC+ A +D   +AG L+  ++  +  ++A+P    IP W +NR KDY+ G+   +++  LDM +R+D+ RL++IR +RG+RH  GL VRGQ
Sbjct:    3 NFRHIVRVAGVDLDGNKQLRWALTAIKGIGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILADPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQ 129          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_PYRAB (30S ribosomal protein S13P OS=Pyrococcus abyssi GN=rps13p PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.083e-24
Identity = 52/127 (40.94%), Postives = 86/127 (67.72%), Query Frame = 1
Query:  106 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            DF+HI+RV   ++DG +++ +ALT+IKG+G   A +VC+ A +D   +AG L+  ++  +  ++ +P    IP W +NR KDY+ G+   +++  LDM +R+D+ RL++IR +RG+RH  GL VRGQ
Sbjct:    3 DFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILQDPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQ 129          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_HYPBU (30S ribosomal protein S13P OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=rps13p PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.083e-24
Identity = 54/131 (41.22%), Postives = 85/131 (64.89%), Query Frame = 1
Query:   94 VANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            ++ + +++I+R+L T++ G  K+ + L  +KGIG  LA  +C+   +D NKR G L+ AE++ +   +ANP    IP W LNR+KDY+ GK   +V   L   ++ D+ER K+IR+ RG+RH  GL+VRGQ
Sbjct:    2 LSEQQYRYIVRILGTDIPGDLKVPYGLALVKGIGVNLAYALCRLLGIDPNKRIGFLTDAEIEKIEKAMANPLAIGIPVWMLNRRKDYETGKDLHLVGADLIYYVKRDIEREKRIRSWRGIRHALGLKVRGQ 132          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_PICTO (30S ribosomal protein S13P OS=Picrophilus torridus GN=rps13p PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 6.965e-24
Identity = 51/129 (39.53%), Postives = 85/129 (65.89%), Query Frame = 1
Query:  100 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            NE+FQ+I+R+ N +++G++ +  AL  +KGIG RL+  + KK D+D ++R GEL   +++ L   +       IP W  N ++D   GK   +VSN LD+++ DD+  +KK+R+++G+RH  GL+VRGQ
Sbjct:    8 NENFQYIVRIANKDLNGERPLKLALADLKGIGLRLSETIAKKLDLDPDQRIGELGEDKIEELRKYIEGKVYDGIPYWMYNHRRDITTGKDFNLVSNDLDLQINDDINLMKKMRSYKGIRHERGLKVRGQ 136          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_METJA (30S ribosomal protein S13P OS=Methanocaldococcus jannaschii GN=rps13p PE=3 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 1.188e-23
Identity = 52/129 (40.31%), Postives = 84/129 (65.12%), Query Frame = 1
Query:  100 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            N +F++++RV  T++DG +K++ AL  I G+G  +A  + + A +D NK AG L+  E+  +  V+A+P +F IP W  NR+KDY  G+   V+ + L +  ++D+ RLK+IR +RG+RH  GL  RGQ
Sbjct:    3 NSEFKYLIRVSRTDLDGNKKLIMALQDIYGVGEAMARAIVRVAKLDPNKLAGYLTEEEVKKIEEVLADPAKFGIPSWMFNRRKDYVTGEDKHVIESDLMIIKQEDINRLKRIRCYRGIRHELGLPCRGQ 131          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_STAMF (30S ribosomal protein S13P OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=rps13p PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.457e-23
Identity = 52/145 (35.86%), Postives = 84/145 (57.93%), Query Frame = 1
Query:  106 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 540
            ++++I+R+  T++DG  K ++ L  IKG+G  LA  +C++  +D   R G L+  E+  +  +++NP  + IP W LNR+KDY  GK   ++   L   ++ D+ER KKI++ RG+RH  GL+VRGQ               KKR
Sbjct:    6 NYRYIVRIAGTDIDGSLKTVYGLAEIKGVGVNLAYGICRRLGIDPEMRIGYLTDEEIKRIEDLLSNPSAYDIPSWMLNRRKDYVTGKDMHLIGAELIFYVKQDIEREKKIKSWRGIRHALGLKVRGQRTRTTGRLGLTVGVRKKR 150          
The following BLAST results are available for this feature:
BLAST of FC931322 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
RS13_METTH4.363e-2640.6330S ribosomal protein S13P OS=Methanobacterium the... [more]
RS13_METS35.698e-2641.4130S ribosomal protein S13P OS=Methanobrevibacter s... [more]
RS13_PYRHO6.300e-2538.6230S ribosomal protein S13P OS=Pyrococcus horikoshi... [more]
RS13_METKA2.394e-2440.6030S ribosomal protein S13P OS=Methanopyrus kandler... [more]
RS13_PYRFU3.127e-2441.7330S ribosomal protein S13P OS=Pyrococcus furiosus ... [more]
RS13_PYRAB4.083e-2440.9430S ribosomal protein S13P OS=Pyrococcus abyssi GN... [more]
RS13_HYPBU4.083e-2441.2230S ribosomal protein S13P OS=Hyperthermus butylic... [more]
RS13_PICTO6.965e-2439.5330S ribosomal protein S13P OS=Picrophilus torridus... [more]
RS13_METJA1.188e-2340.3130S ribosomal protein S13P OS=Methanocaldococcus j... [more]
RS13_STAMF3.457e-2335.8630S ribosomal protein S13P OS=Staphylothermus mari... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103H05EF PostHarvP1 Citrus clementina cDNA clone C34103H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931322 ID=FC931322|Name=FC931322|organism=Citrus clementina|type=EST|length=721bp
GGCAGTTGGCTTGGCTACTTGCTGCAGCTTCATCTGTCGCCGAAGAGCCT
CTCTTCTCTTCATCATCAATCCTCACAATCGAAAATGTCTCTGGTGGCGA
ACGAAGATTTTCAGCACATTTTGCGTGTGCTGAACACTAACGTCGACGGG
AAGCAGAAGATTATGTTTGCTCTTACTTCAATTAAGGGTATTGGAAGGCG
ACTGGCTAACATCGTTTGCAAGAAAGCTGATGTTGACATGAACAAGAGGG
CCGGTGAACTATCTGCTGCTGAACTTGACAATCTCATGGTCGTTGTTGCA
AATCCCCGACAGTTTAAAATCCCTGATTGGTTCTTGAACAGACAGAAGGA
TTACAAGGATGGAAAGTATTCTCAGGTTGTATCCAATGCACTGGACATGA
AGTTGAGAGATGACTTGGAGCGTCTGAAGAAGATCAGGAACCACCGTGGT
CTCAGGCACTACTGGGGTCTTCGTGTCCGTGGACAACACACCAAGACCAC
CGGCCGTCGTGGAAAGACTGTTGGTGTCTCCAAGAAGCGTTGAGCTGTCC
TTTATCAATGTTTTGAACAATCTATACACATGTTCAGGAAGAGTTTGGAC
TTGCTATTGCTGAACATTTGCATCAGACAATATTAGATTTATTTTCTTTT
CTTTGGATGGGTTTTAAGCATTTGAACTGGCTGNCTTTTATCTATTATTT
TCTCTATGGGAATATTTTTAT
back to top