FC931359
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC931359 vs. ExPASy Swiss-Prot
Match: RS4E_METVA (30S ribosomal protein S4e OS=Methanococcus vannielii GN=rps4e PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 4.663e-11 Identity = 33/81 (40.74%), Postives = 52/81 (64.20%), Query Frame = 2 Query: 68 MRGPGKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLIVFIRNRLKYALNGREVKAI--MMQRLVTG*RQGPHRH 304 ++GP KH KRL+AP++W L + T+ + SPGPH + LPL++ +R+ LK A N RE K I M + L+ G ++ ++H Sbjct: 3 IKGPRKHLKRLAAPANWQLPRKERTFTVRPSPGPHSMDKSLPLLLIVRDTLKCADNAREAKKIIQMGKILIDGVKRKEYKH 83
BLAST of FC931359 vs. ExPASy Swiss-Prot
Match: RS4E_METM7 (30S ribosomal protein S4e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps4e PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.954e-11 Identity = 32/81 (39.51%), Postives = 52/81 (64.20%), Query Frame = 2 Query: 68 MRGPGKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLIVFIRNRLKYALNGREVKAIMM--QRLVTG*RQGPHRH 304 ++GP KH KRL+AP++W L + + + SPGPH + LPL++ +R+ LKYA N RE K I+ + L+ G ++ ++H Sbjct: 3 IKGPRKHLKRLAAPANWQLPRKVKAFTVRPSPGPHSMDKSLPLLLVVRDVLKYADNAREAKKIIQTGKILIDGLKRKEYKH 83
BLAST of FC931359 vs. ExPASy Swiss-Prot
Match: RS4E_METM6 (30S ribosomal protein S4e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps4e PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.954e-11 Identity = 32/81 (39.51%), Postives = 52/81 (64.20%), Query Frame = 2 Query: 68 MRGPGKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLIVFIRNRLKYALNGREVKAIMM--QRLVTG*RQGPHRH 304 ++GP KH KRL+AP++W L + + + SPGPH + LPL++ +R+ LKYA N RE K I+ + L+ G ++ ++H Sbjct: 3 IKGPRKHLKRLAAPANWQLPRKVKAFTVRPSPGPHSMDKSLPLLLVVRDILKYADNAREAKKIIQTGKILIDGLKRKEYKH 83 The following BLAST results are available for this feature:
BLAST of FC931359 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 103
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC931359 ID=FC931359; Name=FC931359; organism=Citrus clementina; type=EST; length=679bpback to top |