FC931384

Overview
NameFC931384
Unique NameFC931384
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length744
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15321 contig Ccv1_Contig15321:1..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_HUMAN (60S ribosomal protein L10a OS=Homo sapiens GN=RPL10A PE=1 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 1.683e-60
Identity = 105/195 (53.85%), Postives = 142/195 (72.82%), Query Frame = 1
Query:   67 SKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            SK+  D L EA+  ++ +  +  +R F ET+ELQI LKNYDPQKDKRFSG+V+L   PRPK  VC+LGD QH +EA+ + + +MD+E                  Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E++ +KV+E K+T+KFQ+KKVLC+ VAVG++ M + ++  N+ ++VNFLVSLLKK
Sbjct:    3 SKVSRDTLYEAVREVL-HGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKK 196          

HSP 2 Score: 35.4242 bits (80), Expect = 1.683e-60
Identity = 13/19 (68.42%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVR LY+KSTMG
Sbjct:  193 LLKKNWQNVRALYIKSTMG 211          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_BOVIN (60S ribosomal protein L10a OS=Bos taurus GN=RPL10A PE=2 SV=3)

HSP 1 Score: 219.164 bits (557), Expect = 1.683e-60
Identity = 105/195 (53.85%), Postives = 142/195 (72.82%), Query Frame = 1
Query:   67 SKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            SK+  D L EA+  ++ +  +  +R F ET+ELQI LKNYDPQKDKRFSG+V+L   PRPK  VC+LGD QH +EA+ + + +MD+E                  Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E++ +KV+E K+T+KFQ+KKVLC+ VAVG++ M + ++  N+ ++VNFLVSLLKK
Sbjct:    3 SKVSRDTLYEAVREVL-HGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKK 196          

HSP 2 Score: 35.4242 bits (80), Expect = 1.683e-60
Identity = 13/19 (68.42%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVR LY+KSTMG
Sbjct:  193 LLKKNWQNVRALYIKSTMG 211          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_CHLRE (60S ribosomal protein L10a OS=Chlamydomonas reinhardtii GN=RPL10A PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.195e-60
Identity = 114/196 (58.16%), Postives = 142/196 (72.45%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            MSK+ +D LRE++S++V+ +K T  R F ET+ELQIGLKNYDPQKDKRFSGSV+LP +PRP+M+V   GD +H E+A  IG+D   VE                  YHAFLAS+SVIKQIPRLLGPGLNKAGKFP  +   ++LE  V +TK ++KFQLKKVLCMGVAV N+ M E +I  N+  ++NFLVSLLKK
Sbjct:    1 MSKISNDVLRESVSALVEGAK-TKPRKFQETVELQIGLKNYDPQKDKRFSGSVRLPFVPRPRMRV-RAGDVKHCEQAGAIGVDAKGVEDLKKLNKNKKLVKKLAQAYHAFLASDSVIKQIPRLLGPGLNKAGKFPAPI--NKNLEEMVLDTKCSIKFQLKKVLCMGVAVANVGMTEGEIRTNIMYAINFLVSLLKK 192          

HSP 2 Score: 38.891 bits (89), Expect = 2.195e-60
Identity = 14/19 (73.68%), Postives = 19/19 (100.00%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVRCLY+KSTMG
Sbjct:  189 LLKKNWQNVRCLYIKSTMG 207          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_CAEEL (60S ribosomal protein L10a OS=Caenorhabditis elegans GN=rpl-10a PE=1 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 3.731e-60
Identity = 110/196 (56.12%), Postives = 144/196 (73.47%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            MSK+  ++L EAI+ +++ S E   R F ETIELQIGLKNYDPQKDKRFSGS++L HIPRP MKVC+ GD  H++EA    +  M  +                  Y AF+ASES+IKQIPR+LGPGLNKAGKFP++VTH ESL+SK +E +ATVKFQ+KKVLC+ VAVG++ + ++++  N+ +S+NFLVSLLKK
Sbjct:    1 MSKVSRESLNEAIAEVLKGSSE-KPRKFRETIELQIGLKNYDPQKDKRFSGSIRLKHIPRPNMKVCVFGDQHHLDEAAAGDIPSMSADDLKKLNKQKKLIKKLAKSYDAFIASESLIKQIPRILGPGLNKAGKFPSVVTHGESLQSKSDEIRATVKFQMKKVLCLSVAVGHVGLTQEELVSNISLSINFLVSLLKK 195          

HSP 2 Score: 31.5722 bits (70), Expect = 3.731e-60
Identity = 12/19 (63.16%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVR L +KSTMG
Sbjct:  192 LLKKNWQNVRSLNIKSTMG 210          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_MOUSE (60S ribosomal protein L10a OS=Mus musculus GN=Rpl10a PE=1 SV=3)

HSP 1 Score: 217.238 bits (552), Expect = 6.342e-60
Identity = 104/195 (53.33%), Postives = 141/195 (72.31%), Query Frame = 1
Query:   67 SKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            SK+  D L EA+  ++ +  +  +R F ET+ELQI LKNYDPQKDKRFSG+V+L   PRPK  VC+LGD QH +E + + + +MD+E                  Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E++ +KV+E K+T+KFQ+KKVLC+ VAVG++ M + ++  N+ ++VNFLVSLLKK
Sbjct:    3 SKVSRDTLYEAVREVL-HGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDERKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKK 196          

HSP 2 Score: 35.4242 bits (80), Expect = 6.342e-60
Identity = 13/19 (68.42%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVR LY+KSTMG
Sbjct:  193 LLKKNWQNVRALYIKSTMG 211          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_MACFA (60S ribosomal protein L10a OS=Macaca fascicularis GN=RPL10A PE=2 SV=3)

HSP 1 Score: 215.312 bits (547), Expect = 2.390e-59
Identity = 103/195 (52.82%), Postives = 141/195 (72.31%), Query Frame = 1
Query:   67 SKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            SK+  D L EA+  ++ +  +  +R F ET+ELQI LKNYDPQKDKRFSG+V+L   PRPK  VC+LGD QH +EA+ + + +MD+E                  Y AFLASES+IKQIPR+LGPGLNKAGKFP+ +TH E++ +KV+E K+T+KFQ+K+VLC+ VAVG++ M + ++  N+ ++VNFLVSLLKK
Sbjct:    3 SKVSRDTLYEAVREVL-HGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSPLTHNENMVAKVDEVKSTIKFQMKRVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKK 196          

HSP 2 Score: 35.4242 bits (80), Expect = 2.390e-59
Identity = 13/19 (68.42%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVR LY+KSTMG
Sbjct:  193 LLKKNWQNVRALYIKSTMG 211          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_DICDI (60S ribosomal protein L10a OS=Dictyostelium discoideum GN=rpl10a PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 4.422e-58
Identity = 103/197 (52.28%), Postives = 142/197 (72.08%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXX-YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            MSK+ SD +R  +S + + ++E+ KR F ET+ELQI LKNYD +KDKRFSG +K+  + +PK+ VC+  D QH +EA KIG ++MD+E                   Y AFLASES+++Q+P+LLGPGLNK GKFPTL+TH E + SK+N+ K+TVKFQLKKVLC+ VAVG++ + E+++  N+  S+NFLVSLLKK
Sbjct:    1 MSKISSDQVRSIVSQLFKEAQES-KRGFLETVELQINLKNYDTKKDKRFSGQIKIGTVTKPKLSVCVFADQQHCDEATKIGAEFMDIEALKKIGPKNKKAIKKLSKKYDAFLASESILRQVPKLLGPGLNKVGKFPTLLTHSEDMASKINDVKSTVKFQLKKVLCLAVAVGHIELTEREVATNIIQSINFLVSLLKK 196          

HSP 2 Score: 32.3426 bits (72), Expect = 4.422e-58
Identity = 10/21 (47.62%), Postives = 19/21 (90.48%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMGPS 701
            ++++ WQN++ LY+K++MGPS
Sbjct:  193 LLKKGWQNIKTLYVKTSMGPS 213          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL1_YEAST (60S ribosomal protein L1 OS=Saccharomyces cerevisiae GN=RPL1A PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 4.597e-58
Identity = 109/205 (53.17%), Postives = 144/205 (70.24%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKTGRMSGASI 678
            MSK+ S  +RE +  +++YS ET KRNF ET+ELQ+GLKNYDPQ+DKRFSGS+KLP+ PRP M +C+ GDA  V+ A+  G+D M V+                  Y+AF+ASE +IKQ+PRLLGP L+KAGKFPT V+H + L  KV + ++T+KFQLKKVLC+ VAVGN+ MEE  +   + MSVNF VSLLKK  +  G+ +
Sbjct:    1 MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKKNWQNVGSLV 205          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_ASHGO (60S ribosomal protein L10a OS=Ashbya gossypii GN=RPL10A PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.892e-57
Identity = 108/205 (52.68%), Postives = 145/205 (70.73%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKTGRMSGASI 678
            MSK+ +  +R+ +  +++YS ET KRNF ET+ELQ+GLKNYDPQ+DKRFSG++KLP  PRP M VC+ GDA  V+ A+  G+D M V+                  Y+AF+ASE +IKQ+PRLLGP L+KAGKFPT V+H + L SKV + ++T+KFQLKKVLC+ VAVGN+ M+E  +   + MSVNFLVSLLKK  +  G+ +
Sbjct:    1 MSKITTTHVRDNVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGTLKLPVCPRPNMSVCIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLAKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYSKVTDVRSTIKFQLKKVLCLAVAVGNVEMDEDTLVNQILMSVNFLVSLLKKNWQNVGSLV 205          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL1B_SCHPO (60S ribosomal protein L1-B OS=Schizosaccharomyces pombe GN=rpl1b PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.638e-57
Identity = 109/205 (53.17%), Postives = 149/205 (72.68%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKTGRMSGASI 678
            MSK+   ++R  +  I++ S+E  KRNFTET+ELQIGLKNYDPQ+DKRFSG++KLP++PRP M +C+LGDA  ++ A+  G+D M V+                  Y AF+ASE +IKQIPRLLGPGL+KAGKFP+ V+H + L  K+ E K+T+KFQLKKVLC+GVAVG++ M E+Q+  N+ ++VNFLVSLLKK  +  G+ +
Sbjct:    1 MSKVSVASVRSNVEQILKGSEE-KKRNFTETVELQIGLKNYDPQRDKRFSGTIKLPNVPRPNMAICILGDAHDLDRAKHGGVDAMSVDDLKKLNKNKKLVKKLAKKYDAFIASEVLIKQIPRLLGPGLSKAGKFPSPVSHADDLYGKITEVKSTIKFQLKKVLCLGVAVGHVEMSEEQLIANIMLAVNFLVSLLKKGWQNIGSLV 204          
The following BLAST results are available for this feature:
BLAST of FC931384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
RL10A_HUMAN1.683e-6053.8560S ribosomal protein L10a OS=Homo sapiens GN=RPL1... [more]
RL10A_BOVIN1.683e-6053.8560S ribosomal protein L10a OS=Bos taurus GN=RPL10A... [more]
RL10A_CHLRE2.195e-6058.1660S ribosomal protein L10a OS=Chlamydomonas reinha... [more]
RL10A_CAEEL3.731e-6056.1260S ribosomal protein L10a OS=Caenorhabditis elega... [more]
RL10A_MOUSE6.342e-6053.3360S ribosomal protein L10a OS=Mus musculus GN=Rpl1... [more]
RL10A_MACFA2.390e-5952.8260S ribosomal protein L10a OS=Macaca fascicularis ... [more]
RL10A_DICDI4.422e-5852.2860S ribosomal protein L10a OS=Dictyostelium discoi... [more]
RL1_YEAST4.597e-5853.1760S ribosomal protein L1 OS=Saccharomyces cerevisi... [more]
RL10A_ASHGO3.892e-5752.6860S ribosomal protein L10a OS=Ashbya gossypii GN=R... [more]
RL1B_SCHPO6.638e-5753.1760S ribosomal protein L1-B OS=Schizosaccharomyces ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104E09EF PostHarvP1 Citrus clementina cDNA clone C34104E09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931384 ID=FC931384|Name=FC931384|organism=Citrus clementina|type=EST|length=744bp
GTAGGGTTTCTTTTTCGTCTTCGAAGAAAAAAAAATCTGTAAAGGACTCC
AAGCGCTTCAATCATGAGCAAGCTTCAGAGTGATGCACTGAGAGAGGCCA
TCTCTAGTATTGTGCAATACTCTAAGGAGACAAATAAGAGGAACTTCACC
GAGACTATTGAGCTTCAGATTGGTCTCAAGAACTATGATCCACAAAAGGA
CAAGCGTTTCAGTGGCTCTGTTAAGTTGCCTCACATTCCCCGCCCCAAGA
TGAAGGTCTGCATGCTTGGTGATGCTCAACATGTTGAAGAGGCCGAGAAG
ATTGGTTTGGACTACATGGATGTTGAAGGATTGAAAAAATTGAACAAGAA
CAAGAAATTGGTGAAGAAACTTGCCAAGAAATATCATGCTTTCTTGGCAT
CAGAGTCTGTCATCAAGCAGATTCCTCGTTTGTTGGGTCCTGGTCTCAAC
AAGGCAGGAAAGTTCCCTACCCTTGTTACTCACCAAGAATCCCTGGAGTC
CAAAGTCAACGAGACTAAGGCAACAGTGAAGTTCCAATTGAAGAAGGTGC
TTTGCATGGGAGTTGCTGTCGGAAACCTTTCAATGGAGGAGAAGCAGATC
TTCCAGAATGTTCAAATGAGTGTTAACTTCCTTGTCTCATTGTTGAAGAA
AACTGGCAGAATGTCAGGTGCCTCTATCTGAAGAGTACCATGGGTCCTTC
AACCGCATCTTTTAGAAATCTGCTTTATGTGAGTTTGTAGGGAA
back to top