FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2C_BOVIN (Myocyte-specific enhancer factor 2C OS=Bos taurus GN=MEF2C PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.863e-15
Identity = 40/74 (54.05%), Postives = 58/74 (78.38%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCN 229
            MGR ++++ RI ++ NRQVTF KR+ GL+KKAYELSVLCD E+ALIIF++  KL+++ +S+ M K L +Y + N
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQY-ASTDMDKVLLKYTEYN 73          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2A_XENLA (Myocyte-specific enhancer factor 2A homolog OS=Xenopus laevis GN=mef2a PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.863e-15
Identity = 40/74 (54.05%), Postives = 58/74 (78.38%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCN 229
            MGR ++++ RI ++ NRQVTF KR+ GL+KKAYELSVLCD E+ALIIF++  KL+++ +S+ M K L +Y + N
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQY-ASTDMDKVLLKYTEYN 73          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2A_PONAB (Myocyte-specific enhancer factor 2A OS=Pongo abelii GN=MEF2A PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.863e-15
Identity = 40/74 (54.05%), Postives = 58/74 (78.38%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCN 229
            MGR ++++ RI ++ NRQVTF KR+ GL+KKAYELSVLCD E+ALIIF++  KL+++ +S+ M K L +Y + N
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQY-ASTDMDKVLLKYTEYN 73          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2A_MOUSE (Myocyte-specific enhancer factor 2A OS=Mus musculus GN=Mef2a PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.863e-15
Identity = 40/74 (54.05%), Postives = 58/74 (78.38%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCN 229
            MGR ++++ RI ++ NRQVTF KR+ GL+KKAYELSVLCD E+ALIIF++  KL+++ +S+ M K L +Y + N
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQY-ASTDMDKVLLKYTEYN 73          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2A_CHICK (Myocyte-specific enhancer factor 2A OS=Gallus gallus GN=MEF2A PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.863e-15
Identity = 40/74 (54.05%), Postives = 58/74 (78.38%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCN 229
            MGR ++++ RI ++ NRQVTF KR+ GL+KKAYELSVLCD E+ALIIF++  KL+++ +S+ M K L +Y + N
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQY-ASTDMDKVLLKYTEYN 73          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2B_HUMAN (Myocyte-specific enhancer factor 2B OS=Homo sapiens GN=MEF2B PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 2.228e-14
Identity = 41/89 (46.07%), Postives = 64/89 (71.91%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALE 274
            MGR ++++ RI ++ NRQVTF KR+ GL+KKAYELSVLCD E+ALIIF++  +L+++ +S+ M + L +Y +  Y  P  + +  + LE
Sbjct:    1 MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQY-ASTDMDRVLLKYTE--YSEPHESRTNTDILE 86          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2B_MOUSE (Myocyte-specific enhancer factor 2B OS=Mus musculus GN=Mef2b PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.467e-14
Identity = 40/89 (44.94%), Postives = 64/89 (71.91%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALE 274
            MGR ++++ RI ++ NRQVTF KR+ GL+KKAYELSVLCD ++ALIIF++  +L+++ +SS M + L +Y +  Y  P  + +  + L+
Sbjct:    1 MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCDIALIIFNSAQRLFQY-ASSDMDRVLLKYTE--YSEPHESRTNADILQ 86          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MEF2C_BOVIN5.863e-1554.05Myocyte-specific enhancer factor 2C OS=Bos taurus ... [more]
MEF2A_XENLA5.863e-1554.05Myocyte-specific enhancer factor 2A homolog OS=Xen... [more]
MEF2A_PONAB5.863e-1554.05Myocyte-specific enhancer factor 2A OS=Pongo abeli... [more]
MEF2A_MOUSE5.863e-1554.05Myocyte-specific enhancer factor 2A OS=Mus musculu... [more]
MEF2A_CHICK5.863e-1554.05Myocyte-specific enhancer factor 2A OS=Gallus gall... [more]
MEF2B_HUMAN2.228e-1446.07Myocyte-specific enhancer factor 2B OS=Homo sapien... [more]
MEF2B_MOUSE8.467e-1444.94Myocyte-specific enhancer factor 2B OS=Mus musculu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top