FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD14_ORYSJ (MADS-box transcription factor 14 OS=Oryza sativa subsp. japonica GN=MADS14 PE=1 SV=2)

HSP 1 Score: 198.749 bits (504), Expect = 2.520e-50
Identity = 116/234 (49.57%), Postives = 155/234 (66.24%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLXIGYQPA---DPISVVTAG 700
            MGRG+V+LKRIENKINRQVTF+KRR+GLLKKA E+SVLCDAEVALIIFS +GKLYE+ + S M K LERY++ +Y A +  +SA    + +   EY KLKA+ E +Q+ Q++L+GE+L  LN KEL+ LE+QL+ SLK IRS ++Q ML+++ ELQ KE+ L E NK L++ L+E  +V   Q+           +P      + F   E  PT  I   PA   + I  V AG
Sbjct:    1 MGRGKVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYEYATDSCMDKILERYERYSY-AEKVLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKELVEKQKVQKQQVQWDQ------TQPQTSSSSSSFMMREALPTTNISNYPAAAGERIEDVAAG 227          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL6_ARATH (Agamous-like MADS-box protein AGL6 OS=Arabidopsis thaliana GN=AGL6 PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 1.251e-49
Identity = 118/226 (52.21%), Postives = 150/226 (66.37%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL-MEGYQVNTLQ---LNPSAEDCGYGLKPAQPQGDTFFHALEC--EPTLXIGYQ 667
            MGRGRVE+KRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLYEF  S  +  T+ERY +C Y     N    E  + S  QE  KLK++YE+L R+ RNLLGE+LG +  KEL++LERQL+ +L   R  +TQ M++ + +L+ KE+ L + NK LK +   EG+   T Q    N +A   G       P   +  + L+C  EP L IG+Q
Sbjct:    1 MGRGRVEMKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEF-GSVGIESTIERYNRC-YNCSLSNNKPEETTQ-SWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQLEAALTATRQRKTQVMMEEMEDLRKKERQLGDINKQLKIKFETEGHAFKTFQDLWANSAASVAGDPNNSEFPVEPSHPNVLDCNTEPFLQIGFQ 223          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD14_ORYSI (MADS-box transcription factor 14 OS=Oryza sativa subsp. indica GN=MADS14 PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.639e-49
Identity = 114/234 (48.72%), Postives = 154/234 (65.81%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLXIGYQPA---DPISVVTAG 700
            MGRG+V+LKRIEN INRQVTF+KRR+GLLKKA E+SVLCDAEVALIIFS +GKLY++ + S M K LERY++ +Y A +  +SA    + +   EY KLKA+ E +Q+ Q++L+GE+L  LN KEL+ LE+QL+ SLK IRS ++Q ML+++ ELQ KE+ L E NK L++ L+E  +V   Q+           +P      + F   E  PT  I   PA   + I  V AG
Sbjct:    1 MGRGKVQLKRIENTINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYKYATDSCMDKILERYERYSY-AEKVLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKELVEKQKVQKQQVQWDQ------TQPQTSSSSSSFMMREALPTTNISNYPAAAGERIEDVAAG 227          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AP1_SINAL (Floral homeotic protein APETALA 1 OS=Sinapis alba GN=AP1 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.806e-48
Identity = 109/238 (45.80%), Postives = 159/238 (66.81%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYG-----APEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNP-SAEDCGYGLKPAQPQGD---TFFHALECEPTLXIG--YQPADPISV 688
            MGRGRV+LKRIENKINRQVTF+KRR GLLKKA+E+SVLCDAEVAL++FS++GKL+E+ + S M K LERY++ +Y      APE +V+   ++      EY +LKA+ E L+R+QR+ LGE+L  ++SKEL++LE+QLD +LK IRS + Q M D++ ELQ KE+ + E N  L +++ E  ++   Q      ++ G+ + P  P       +  + +  P L +G  YQ  DP+ +
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDVNTNWSM------EYNRLKAKIELLERNQRHYLGEDLQAMSSKELQNLEQQLDTALKHIRSRKNQLMHDSINELQRKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNHGHNMPPPPPPQQIQHPYMLSHQPSPFLNMGGLYQEEDPMEM 232          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: CAL_ARATH (Transcription factor CAULIFLOWER OS=Arabidopsis thaliana GN=CAL PE=1 SV=3)

HSP 1 Score: 189.889 bits (481), Expect = 1.170e-47
Identity = 114/242 (47.11%), Postives = 155/242 (64.05%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYG-----APEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL------KQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFH------ALECEPTLXIG--YQPAD 676
            MGRGRVELKRIENKINRQVTF+KRR GLLKKA E+SVLCDAEV+LI+FS++GKL+E+ S S M K LERY++ +Y      AP+ +V+A    + +   EY +LKA+ E L+R+QR+ LGEEL P++ K+L++LE+QL+ +LK IRS + Q M ++L  LQ KE+ + E N  L      ++ ++   Q    QLN S +D         PQ   F H      A +  P L +G  YQ  D
Sbjct:    1 MGRGRVELKRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSSESCMEKVLERYERYSYAERQLIAPDSHVNA----QTNWSMEYSRLKAKIELLERNQRHYLGEELEPMSLKDLQNLEQQLETALKHIRSRKNQLMNESLNHLQRKEKEIQEENSMLTKQIKERENILRTKQTQCEQLNRSVDDV--------PQPQPFQHPHLYMIAHQTSPFLNMGGLYQEED 230          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD15_ORYSJ (MADS-box transcription factor 15 OS=Oryza sativa subsp. japonica GN=MADS15 PE=1 SV=2)

HSP 1 Score: 189.504 bits (480), Expect = 1.529e-47
Identity = 99/175 (56.57%), Postives = 134/175 (76.57%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRG+V+LKRIENKINRQVTF+KRRNGLLKKA+E+SVLCDAEVA I+FS +GKLYE+ + S M K LERY++ +Y A +  +SA    E +   EY KLKA+ E +Q+  ++L+GE+L  LN KEL+ LE+QL+ SLK I S ++  ML++++ELQ KE+ L E NK L++ L+E
Sbjct:    1 MGRGKVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYATDSRMDKILERYERYSY-AEKALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQKELVE 174          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AP1_ARATH (Floral homeotic protein APETALA 1 OS=Arabidopsis thaliana GN=AP1 PE=1 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 7.587e-47
Identity = 106/240 (44.17%), Postives = 159/240 (66.25%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYG-----APEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNP-SAEDCGYGLKPAQPQGD-----TFFHALECEPTLXIG--YQPADPISV 688
            MGRGRV+LKRIENKINRQVTF+KRR GLLKKA+E+SVLCDAEVAL++FS++GKL+E+ + S M K LERY++ +Y      APE +V+   ++      EY +LKA+ E L+R+QR+ LGE+L  ++ KEL++LE+QLD +LK IR+ + Q M +++ ELQ KE+ + E N  L +++ E  ++   Q      ++ G+ + P  P         +  + +  P L +G  YQ  DP+++
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDVNTNWSM------EYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRTRKNQLMYESINELQKKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNQGHNMPPPLPPQQHQIQHPYMLSHQPSPFLNMGGLYQEDDPMAM 234          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD18_ORYSJ (MADS-box transcription factor 18 OS=Oryza sativa subsp. japonica GN=MADS18 PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.388e-46
Identity = 101/193 (52.33%), Postives = 135/193 (69.95%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNY---GAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAED 577
            MGRG V+L+RIENKINRQVTF+KRRNGLLKKA+E+SVLCDA+VALI+FS +GKLYEF S SSM   LERYQ+ ++      EPN   +E    +   EY  LK++ +ALQ+SQR LLGE+L  L  KEL+ LE QL+ SLK IRS + Q + ++++ELQ KE+ L   N  L++ +    + N   +N + E+
Sbjct:    1 MGRGPVQLRRIENKINRQVTFSKRRNGLLKKAHEISVLCDADVALIVFSTKGKLYEFSSHSSMEGILERYQRYSFDERAVLEPNTEDQE----NWGDEYGILKSKLDALQKSQRQLLGEQLDTLTIKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKSLKNQNNVLQKLMETEKEKNNAIINTNREE 189          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD18_ORYSI (MADS-box transcription factor 18 OS=Oryza sativa subsp. indica GN=MADS18 PE=2 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 8.388e-46
Identity = 101/193 (52.33%), Postives = 135/193 (69.95%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNY---GAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAED 577
            MGRG V+L+RIENKINRQVTF+KRRNGLLKKA+E+SVLCDA+VALI+FS +GKLYEF S SSM   LERYQ+ ++      EPN   +E    +   EY  LK++ +ALQ+SQR LLGE+L  L  KEL+ LE QL+ SLK IRS + Q + ++++ELQ KE+ L   N  L++ +    + N   +N + E+
Sbjct:    1 MGRGPVQLRRIENKINRQVTFSKRRNGLLKKAHEISVLCDADVALIVFSTKGKLYEFSSHSSMEGILERYQRYSFDERAVLEPNTEDQE----NWGDEYGILKSKLDALQKSQRQLLGEQLDTLTIKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKSLKNQNNVLQKLMETEKEKNNAIINTNREE 189          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL8_SINAL (Agamous-like MADS-box protein AGL8 homolog OS=Sinapis alba GN=AGL8 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.698e-44
Identity = 99/204 (48.53%), Postives = 139/204 (68.14%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPE---PNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQ 610
            MGRGRV+LKRIENKINRQVTF+KRR+GLLKKA+E+SVLCDAEVAL+IFS++GKL+E+ + S M K LERY +  Y   +    ++S  E   L    E+ KLKAR E L++++RN +GE+L  L+ KEL+SLE QL  ++K IRS + Q M ++++ LQ K+++L + N  L +++ E  + NT+        C       QPQ
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALVIFSSKGKLFEYSTDSCMEKILERYDRYLYSDKQLVGRDISQSENWVL----EHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLHAAIKSIRSRKNQAMFESISALQKKDKVLQDHNNALLKKIKE-REKNTVHQEVQLIQCSNNSSILQPQ 199          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MAD14_ORYSJ2.520e-5049.57MADS-box transcription factor 14 OS=Oryza sativa s... [more]
AGL6_ARATH1.251e-4952.21Agamous-like MADS-box protein AGL6 OS=Arabidopsis ... [more]
MAD14_ORYSI3.639e-4948.72MADS-box transcription factor 14 OS=Oryza sativa s... [more]
AP1_SINAL1.806e-4845.80Floral homeotic protein APETALA 1 OS=Sinapis alba ... [more]
CAL_ARATH1.170e-4747.11Transcription factor CAULIFLOWER OS=Arabidopsis th... [more]
MAD15_ORYSJ1.529e-4756.57MADS-box transcription factor 15 OS=Oryza sativa s... [more]
AP1_ARATH7.587e-4744.17Floral homeotic protein APETALA 1 OS=Arabidopsis t... [more]
MAD18_ORYSJ8.388e-4652.33MADS-box transcription factor 18 OS=Oryza sativa s... [more]
MAD18_ORYSI8.388e-4652.33MADS-box transcription factor 18 OS=Oryza sativa s... [more]
AGL8_SINAL2.698e-4448.53Agamous-like MADS-box protein AGL8 homolog OS=Sina... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top