FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD56_ORYSJ (MADS-box transcription factor 56 OS=Oryza sativa subsp. japonica GN=MADS56 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.136e-34
Identity = 82/170 (48.24%), Postives = 113/170 (66.47%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLK 517
            M RGR ELKRIEN  +RQVTF+KRRNGLLKKA+ELSVLCDAEVALI+FS RG+LYEF S+ S+ KT++RY+   Y     N    +      + + L L  + EAL  S+R +LGE L   + +EL  LE +L+ SL +IR  +T+ +   + +L+ KE+ L + N+ L+
Sbjct:    1 MVRGRTELKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFASAPSLQKTIDRYKA--YTKDHVNNKTIQQDIQQVKDDTLGLAKKLEALDESRRKILGENLEGFSIEELRGLEMKLEKSLHKIRLKKTELLEQQIAKLKEKERTLLKDNENLR 168          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD56_ORYSI (MADS-box transcription factor 56 OS=Oryza sativa subsp. indica GN=MADS56 PE=2 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 3.306e-34
Identity = 82/170 (48.24%), Postives = 112/170 (65.88%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLK 517
            M RGR ELKRIEN  +RQVTF+KRRNGLLKKA+ELSVLCDAEVALI+FS RG+LYEF S+ S+ KT++RY+   Y     N    +      + + L L  + EAL  S+R +LGE L   + +EL  LE +L+ SL  IR  +T+ +   + +L+ KE+ L + N+ L+
Sbjct:    1 MVRGRTELKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFASAPSLQKTIDRYKA--YTKDHVNNKTIQQDIQQVKDDTLGLAKKLEALDESRRKILGENLEGCSIEELRGLEMKLEKSLHNIRLKKTELLERQIAKLKEKERTLLKDNENLR 168          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL19_ARATH (Agamous-like MADS-box protein AGL19 OS=Arabidopsis thaliana GN=AGL19 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.640e-34
Identity = 85/172 (49.42%), Postives = 116/172 (67.44%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQR 523
            M RG+ E+KRIEN  +RQVTF+KRRNGLLKKA+ELSVLCDAEVAL+IFS R KLYEF SSSS+  T+ERYQ+        N   R      ++ E   L  + E L+ S+R LLGE +   + +EL+ LE QLD SL +IR+ + Q + + + +L+ +E+ L + NK LK++
Sbjct:    1 MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEF-SSSSIAATIERYQR--RIKEIGNNHKRNDNSQQARDETSGLTKKIEQLEISKRKLLGEGIDACSIEELQQLENQLDRSLSRIRAKKYQLLREEIEKLKAEERNLVKENKDLKEK 169          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS3_ORYSJ (MADS-box transcription factor 3 OS=Oryza sativa subsp. japonica GN=MADS3 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.256e-33
Identity = 89/236 (37.71%), Postives = 138/236 (58.47%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQR-SQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQ-VNTLQLNPSAEDCGYGLKPAQPQGDTFF-----------HALECEP-TLXIGYQPA 673
            MGRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVALI+FS+RG+LYE+ +++S+  T+ERY+K N         A E      QQE  KL+ +  +LQ  + R ++G+ +  ++ ++L+ +E +L+  + +IR+ + + +   +  +Q +E  L   N  L+ +++E  +    L +  +A    Y      P     F           +A + +P TL +G QPA
Sbjct:    1 MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY-ANNSVKSTVERYKKANSDTSNSGTVA-EVNAQHYQQESSKLRQQISSLQNANSRTIVGDSINTMSLRDLKQVENRLEKGIAKIRARKNELLYAEVEYMQKREVELQNDNMYLRSKVVENERGQQPLNMMGAASTSEYDHMVNNPYDSRNFLQVNIMQQPQHYAHQLQPTTLQLGQQPA 234          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD27_ORYSJ (MADS-box transcription factor 27 OS=Oryza sativa subsp. japonica GN=MADS27 PE=2 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 2.143e-33
Identity = 77/174 (44.25%), Postives = 115/174 (66.09%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSS-QQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL 526
            MGRG++ ++RI+N  +RQVTF+KRRNG+ KKA EL++LCDAEV L+IFS+ G+LYE+ SS+SM   ++RY K      E    A    EL   Q+E   L+ +   LQ + R L+GE+L  LN KEL+SLE QL++SL+ +R+ +   ++D + EL  K  L+ + N  L +++
Sbjct:    1 MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEY-SSTSMKSVIDRYGK---SKDEQQAVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNVKELQSLENQLEISLRSVRTKKDHVLIDEIHELNRKGSLVHQENMELYKKI 170          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD50_ORYSJ (MADS-box transcription factor 50 OS=Oryza sativa subsp. japonica GN=MADS50 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.774e-33
Identity = 84/175 (48.00%), Postives = 121/175 (69.14%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQ---KCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQR 523
            M RG+ ++KRIEN  +RQVTF+KRRNGLLKKA+ELSVLCDAEVALI+FS RGKLYEF S+S+  KT+ERY+   K N G    N + ++ +E   + +   L  + EAL+  +R LLGE+L   + +EL SLE +L+ SL  IR  +T+ + + + +L+ KE  L + N+ L+++
Sbjct:    1 MVRGKTQMKRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFASASTQ-KTIERYRTYTKENIG----NKTVQQDIE-QVKADADGLAKKLEALETYKRKLLGEKLDECSIEELHSLEVKLERSLISIRGRKTKLLEEQVAKLREKEMKLRKDNEELREK 169          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD20_ORYSJ (MADS-box transcription factor 20 OS=Oryza sativa subsp. japonica GN=MADS20 PE=2 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 6.235e-33
Identity = 85/207 (41.06%), Postives = 126/207 (60.87%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS-SSMLKTLERYQKCNYGAPEPNVSAR-EALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTF 622
            MGRG+V+++RIEN+++RQVTF+KRR GLLKKA+E++VLCD +VA I+FS +G L+ + SS ++M + LE+Y +    +   NV      LE S   +++KL+ R EAL++SQRNL+G+EL  L  ++++ LE Q+D SL  IRS               KE+LL E N  L++++ E   + TL     A        PA    D F
Sbjct:    1 MGRGKVQVRRIENEVSRQVTFSKRRPGLLKKAHEIAVLCDVDVAAIVFSAKGNLFHYASSHTTMERILEKYDRHELLSEGNNVIEEFPELEGSMSYDHIKLRGRIEALKKSQRNLMGQELDSLTLQDIQQLENQIDTSLNNIRS--------------RKEKLLMEKNTILEKKITE---LETLHTCIRASPTKAAAPPACNTADAF 190          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL21_ARATH (Agamous-like MADS-box protein AGL21 OS=Arabidopsis thaliana GN=AGL21 PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.894e-32
Identity = 77/181 (42.54%), Postives = 114/181 (62.98%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSS-QQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVN 547
            MGRG++ ++RI++  +RQVTF+KRR GL+KKA EL++LCDAEV LIIFS+ GKLY+F +SSSM   ++RY K      E       A E+   Q+E   L+    ALQ + R ++GE+L  L+  EL SLE Q+++SL+ IR  + Q +   + EL  K  L+ + N  L +++   +Q N
Sbjct:    1 MGRGKIVIQRIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLIIFSSTGKLYDF-ASSSMKSVIDRYNKSKI---EQQQLLNPASEVKFWQREAAVLRQELHALQENHRQMMGEQLNGLSVNELNSLENQIEISLRGIRMRKEQLLTQEIQELSQKRNLIHQENLDLSRKVQRIHQEN 177          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD33_ORYSJ (MADS-box transcription factor 33 OS=Oryza sativa subsp. japonica GN=MADS33 PE=2 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 9.004e-32
Identity = 82/209 (39.23%), Postives = 129/209 (61.72%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQ-KCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQ--GDTFF 625
            M RG+V+++RIEN ++RQVTF KRR GLLKKA ELSVLCDA+V +IIFS++GKL+E  ++ +M   +ERYQ     G  EP    R+ +   ++Q    L+   + LQR  R+  G   G +   +L +LE+ L++ + QIR+T+ Q M   +  L++KE +L EAN+ L++++ E  ++    L+  ++      +P QP   G+ FF
Sbjct:    1 MVRGKVQMRRIENPVHRQVTFCKRRGGLLKKARELSVLCDADVGVIIFSSQGKLHELATNGNMHNLVERYQSNVAGGQMEPGALQRQQV---AEQGIFLLREEIDLLQRGLRSTYGGGAGEMTLDKLHALEKGLELWIYQIRTTKMQMMQQEIQFLRNKEGILKEANEMLQEKVKEQQKLYMSLLDLHSQ------QPTQPMTYGNRFF 200          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL15_BRANA (Agamous-like MADS-box protein AGL15 OS=Brassica napus GN=AGL15 PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.004e-32
Identity = 80/175 (45.71%), Postives = 112/175 (64.00%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRG++E+KRIEN  +RQVTF+KRR GLLKKA+ELSVLCDAEVA+I+FS  GKL+EF SS+SM KTL RY      +  P ++ +   +    +  L LK     LQ    ++ G+ L  L+ KEL+ LE+QL+ SL  +R  +   +   L E + KEQ     N+TL++++ E
Sbjct:    1 MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEF-SSTSMKKTLLRYGNYQISSDVPGINCKTENQEECTEVDL-LKDEISMLQEKHLHMQGKPLNLLSLKELQHLEKQLNFSLISVRERKELLLTKQLEESRLKEQRAELENETLRRQVQE 173          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MAD56_ORYSJ1.136e-3448.24MADS-box transcription factor 56 OS=Oryza sativa s... [more]
MAD56_ORYSI3.306e-3448.24MADS-box transcription factor 56 OS=Oryza sativa s... [more]
AGL19_ARATH5.640e-3449.42Agamous-like MADS-box protein AGL19 OS=Arabidopsis... [more]
MADS3_ORYSJ1.256e-3337.71MADS-box transcription factor 3 OS=Oryza sativa su... [more]
MAD27_ORYSJ2.143e-3344.25MADS-box transcription factor 27 OS=Oryza sativa s... [more]
MAD50_ORYSJ4.774e-3348.00MADS-box transcription factor 50 OS=Oryza sativa s... [more]
MAD20_ORYSJ6.235e-3341.06MADS-box transcription factor 20 OS=Oryza sativa s... [more]
AGL21_ARATH6.894e-3242.54Agamous-like MADS-box protein AGL21 OS=Arabidopsis... [more]
MAD33_ORYSJ9.004e-3239.23MADS-box transcription factor 33 OS=Oryza sativa s... [more]
AGL15_BRANA9.004e-3245.71Agamous-like MADS-box protein AGL15 OS=Brassica na... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top