FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS4_ORYSJ (MADS-box transcription factor 4 OS=Oryza sativa subsp. japonica GN=MADS4 PE=1 SV=3)

HSP 1 Score: 106.686 bits (265), Expect = 1.303e-22
Identity = 67/183 (36.61%), Postives = 104/183 (56.83%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSS------MLKTLERYQ----KCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL 526
            MGRG++E+KRIEN  NRQVTF+KRR G+LKKA E+ VLCDAEV ++IFS+ GKL ++C+  +      + + LE+YQ    K  +     ++SA          E  ++K   + +Q   R++ GE+L  L  KEL ++E  L+     +R      M+D     +  E++L + +K L  R+
Sbjct:    1 MGRGKIEIKRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVGVVIFSSAGKLSDYCTPKTTSVFPPLSRILEKYQTNSGKILWDEKHKSLSA----------EIDRVKKENDNMQIELRHMKGEDLNSLQPKELIAIEEALNNGQANLRDK----MMDHWRMHKRNEKMLEDEHKMLAFRV 169          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: DEFA_ANTMA (Floral homeotic protein DEFICIENS OS=Antirrhinum majus GN=DEFA PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.303e-22
Identity = 68/196 (34.69%), Postives = 109/196 (55.61%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTL-ERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGL 592
            M RG++++KRIEN+ NRQVT++KRRNGL KKA+ELSVLCDA+V++I+ S+  KL+E+ S ++  K L ++YQK         V    +     Q+   KL      L+R  R  +GE L  L  +++ +L   +D SLK IR  + + + + +   + K + + E ++ L            L+ +   ED  +GL
Sbjct:    1 MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISPTTATKQLFDQYQKA------VGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQIVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNL-----------VLEFDARREDPHFGL 179          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AP3_ARATH (Floral homeotic protein APETALA 3 OS=Arabidopsis thaliana GN=AP3 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.210e-21
Identity = 68/196 (34.69%), Postives = 113/196 (57.65%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTL-ERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGL 592
            M RG++++KRIEN+ NRQVT++KRRNGL KKA+EL+VLCDA V++I+FS+  KL+E+ S ++  K + + YQ  +    + +V A +   +  Q+   KL      L+   +  LGE L  L+ +EL  LE +++ + K +R  + + + + +   + K +   +  K L         ++ L+L   AED  YGL
Sbjct:    1 MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISPNTTTKEIVDLYQTIS----DVDVWATQYERM--QETKRKLLETNRNLRTQIKQRLGECLDELDIQELRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNL---------IHELELR--AEDPHYGL 179          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: CMB2_DIACA (MADS-box protein CMB2 OS=Dianthus caryophyllus GN=CMB2 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.635e-20
Identity = 60/174 (34.48%), Postives = 100/174 (57.47%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS-SMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL 526
            MGRG++E+++IENK NRQVTF+KRRNG++KKA EL+VLCDA+V+L++ S+  KL+ + S   S+ K  + YQK         V          Q+++ K+      L+R     +G +L  L   EL +L+++++ ++ QIR+ +   + +     + K + L E +  L   L
Sbjct:    1 MGRGKLEIRKIENKTNRQVTFSKRRNGIMKKAQELTVLCDAKVSLLMISSTHKLHHYLSPGVSLKKMYDEYQKIE------GVDLWRKQWERMQEQHRKVLELNSLLRREISRRMGGDLEGLTLVELSALQQEMEEAIIQIRNKKYHTIKNQTGTTRKKIKNLEERHTDLVMEL 168          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AP32_ASAEU (MADS-box protein AeAP3-2 (Fragment) OS=Asarum europaeum GN=AP3-2 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.033e-19
Identity = 61/170 (35.88%), Postives = 99/170 (58.24%), Query Frame = 2
Query:   86 GLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS-SMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYL---KLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQ--LNPSAED 577
            GLLKKA EL++LCDA++ +IIFS+ GK++EF S   SM + ++RYQK         +S   A    +QQ Y    ++K   + LQ + R+  GE+L  L   E+  LE+QL++S+ ++RS + Q +   L  L+ KE +L E N+ L + + + +  +  Q  ++PS  D
Sbjct:    2 GLLKKARELAILCDAQLGVIIFSSSGKMFEFSSPPISMREIIDRYQK---------LSGNCAPVYDNQQVYCEITRMKNEIDKLQATMRHFAGEDLTSLTMNEMLQLEQQLEISVNKVRSRKEQLLQQQLDNLRRKENMLEEQNRELYRVIQDHHAASMEQKMVDPSMLD 162          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD32_ORYSJ (MADS-box transcription factor 32 OS=Oryza sativa subsp. japonica GN=MADS32 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.924e-19
Identity = 62/198 (31.31%), Postives = 105/198 (53.03%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS--SMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLK 595
            MGRGR E+KRIEN   RQ TF KRR+GL KKA EL+VLCDA++ L++FS  GKLY F S +  S+ + +ERY+   +     ++      EL       K+ +  + L++  R +  ++        LE+LE  L+ +++++RS + + +   +  LQ+  +   E    L  ++     +  ++   ++   G  LK
Sbjct:    1 MGRGRSEIKRIENPTQRQSTFYKRRDGLFKKARELAVLCDADLLLLLFSASGKLYHFLSPTVPSVREFVERYEATTHTKVWADIRQERRAELE------KVGSMCDLLEKQLRFMTVDDGEEYTVPSLEALEHNLEAAMRKVRSEKDRKIGGEICYLQNIIRGRQEERYGLCDKIAHAQTLKDVECGSTSLSNGLDLK 192          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2C_PIG (Myocyte-specific enhancer factor 2C OS=Sus scrofa GN=MEF2C PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.060e-16
Identity = 48/131 (36.64%), Postives = 78/131 (59.54%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERY--------------------QKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQR 340
            MGR ++++ RI ++ NRQVTF KR+ GL+KKAYELSVLCD E+ALIIF++  KL+++ +S+ M K L +Y                    +K N G   P+  +  AL   ++++Y K+   ++ + +S +
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQY-ASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENKGCESPDPDSSYALTPRTEEKYKKINEEFDNMIKSHK 130          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2_DROME (Myocyte-specific enhancer factor 2 OS=Drosophila melanogaster GN=Mef2 PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 1.543e-15
Identity = 42/89 (47.19%), Postives = 65/89 (73.03%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALE 274
            MGR ++++ RI ++ NRQVTF KR+ G++KKAYELSVLCD E+ALIIFS+  KLY++ +S+ M + L +Y +  Y  P  +++ +  +E
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQY-ASTDMDRVLLKYTE--YNEPHESLTNKNIIE 86          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2D_XENLA (Myocyte-specific enhancer factor 2D homolog OS=Xenopus laevis GN=mef2d PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.543e-15
Identity = 44/87 (50.57%), Postives = 64/87 (73.56%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREA 268
            MGR +++++RI ++ NRQVTF KR+ GL+KKAYELSVLCD E+ALIIF++  KL+++ +S+ M K L +Y + N    EP+ S   A
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQY-ASTDMDKVLLKYTEYN----EPHESRTNA 82          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MEF2D_RAT (Myocyte-specific enhancer factor 2D OS=Rattus norvegicus GN=Mef2d PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.543e-15
Identity = 44/87 (50.57%), Postives = 64/87 (73.56%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREA 268
            MGR +++++RI ++ NRQVTF KR+ GL+KKAYELSVLCD E+ALIIF++  KL+++ +S+ M K L +Y + N    EP+ S   A
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQY-ASTDMDKVLLKYTEYN----EPHESRTNA 82          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MADS4_ORYSJ1.303e-2236.61MADS-box transcription factor 4 OS=Oryza sativa su... [more]
DEFA_ANTMA1.303e-2234.69Floral homeotic protein DEFICIENS OS=Antirrhinum m... [more]
AP3_ARATH3.210e-2134.69Floral homeotic protein APETALA 3 OS=Arabidopsis t... [more]
CMB2_DIACA4.635e-2034.48MADS-box protein CMB2 OS=Dianthus caryophyllus GN=... [more]
AP32_ASAEU1.033e-1935.88MADS-box protein AeAP3-2 (Fragment) OS=Asarum euro... [more]
MAD32_ORYSJ3.924e-1931.31MADS-box transcription factor 32 OS=Oryza sativa s... [more]
MEF2C_PIG4.060e-1636.64Myocyte-specific enhancer factor 2C OS=Sus scrofa ... [more]
MEF2_DROME1.543e-1547.19Myocyte-specific enhancer factor 2 OS=Drosophila m... [more]
MEF2D_XENLA1.543e-1550.57Myocyte-specific enhancer factor 2D homolog OS=Xen... [more]
MEF2D_RAT1.543e-1550.57Myocyte-specific enhancer factor 2D OS=Rattus norv... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top