FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: EXS_ARATH (Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.146e-50
Identity = 100/216 (46.30%), Postives = 140/216 (64.81%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV--TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRP 647
            + R  D+  AT  F +K ++G GGFG VY+  LP  K  +AVKK+S    QG +EF+AE+ ++G+++H NLV LLGYC    E LLVY+YM NGSLD +L NQ  +   L+W +R  +  G A GL +LH  +   +IHRD+KASN+LLDG+   ++ DFGLARL        +T + GT GY+ PE+ ++ +ATT  DV+SFG  LLE+  G+ P
Sbjct:  904 KVRLGDIVEATDHFSKKNIIGDGGFGTVYKACLPGEKT-VAVKKLSEAKTQGNREFMAEMETLGKVKHPNLVSLLGYCSFSEEKLLVYEYMVNGSLDHWLRNQTGMLEVLDWSKRLKIAVGAARGLAFLHHGFIPHIIHRDIKASNILLDGDFEPKVADFGLARLISACESHVSTVIAGTFGYIPPEYGQSARATTKGDVYSFGVILLELVTGKEP 1118          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK39_ARATH (Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana GN=CRK39 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.146e-50
Identity = 101/215 (46.98%), Postives = 144/215 (66.98%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTL-NWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHG-TDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            RF    +  AT  F  +  LG GGFG VY+GTL   + E+AVK+++  S QG  EF  E+  + RL+HRNLV+LLG+C    E +LVY+++PN SLD ++++  K +L  W  RY +I+G+A GLLYLHE+ +  +IHRD+KASN+LLD E+N ++ DFG ARL+D   T  +T  + GT GY+APE+   G+ +  +DV+SFG  LLE+  G R
Sbjct:  340 RFDLGMVLAATDEFSSENTLGQGGFGTVYKGTLLNGQ-EVAVKRLTKGSGQGDIEFKNEVSLLTRLQHRNLVKLLGFCNEGDEQILVYEFVPNSSLDHFIFDDEKRSLLTWEMRYRIIEGIARGLLYLHEDSQLKIIHRDLKASNILLDAEMNPKVADFGTARLFDSDETRAETKRIAGTRGYMAPEYLNHGQISAKSDVYSFGVMLLEMISGER 553          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK4_ARATH (Cysteine-rich receptor-like protein kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 5.367e-50
Identity = 91/215 (42.33%), Postives = 149/215 (69.30%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP-KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +K +  AT  F E   LG GGFG VY+G  P S +++AVK++S  S QG +EF  E++ + +L+HRNLV+LLG+C  + E +LVY+++PN SLD ++++   +  L+W +RY +I G+A G+LYLH++    +IHRD+KA N+LL  ++N ++ DFG+AR++    T+  T  +VGT GY++PE++  G+ +  +DV+SFG  +LE+  G++
Sbjct:  338 QFDFKAIEAATNKFCETNKLGQGGFGEVYKGIFP-SGVQVAVKRLSKTSGQGEREFANEVIVVAKLQHRNLVRLLGFCLERDERILVYEFVPNKSLDYFIFDSTMQSLLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLGDDMNAKIADFGMARIFGMDQTEANTRRIVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGKK 551          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK29_ARATH (Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana GN=CRK29 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 100/214 (46.73%), Postives = 147/214 (68.69%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK-VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHG---TDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            ++ L  AT  F  +  LG GGFG VY+G  P+ + EIAVK++S  S QG  EF  EI+ + +L+HRNLV+L+G+C +  E LLVY+++ N SLD+++++  K   L+W  RY +I G+A GLLYLHE+    +IHRD+KASN+LLD E+N ++ DFGLA+L+D G   T   T+ + GT GY+APE++  G+ +   DVFSFG  ++E+  G+R
Sbjct:  347 FETLKTATDNFSSENELGRGGFGSVYKGVFPQGQ-EIAVKRLSGNSGQGDNEFKNEILLLAKLQHRNLVRLIGFCIQGEERLLVYEFIKNASLDQFIFDTEKRQLLDWVVRYKMIGGIARGLLYLHEDSRFRIIHRDLKASNILLDQEMNPKIADFGLAKLFDSGQTMTHRFTSRIAGTYGYMAPEYAMHGQFSVKTDVFSFGVLVIEIITGKR 559          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK23_ARATH (Putative cysteine-rich receptor-like protein kinase 23 OS=Arabidopsis thaliana GN=CRK23 PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.196e-49
Identity = 96/215 (44.65%), Postives = 146/215 (67.91%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP-KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +K +  AT  F     LG GGFG VY+GT P S +++AVK++S  S QG +EF  E+V + +L+HRNLV+LLGYC    E +LVY+++ N SLD +L++   K  L+W +RY +I G+A G+LYLH++    +IHRD+KA N+LLD ++N ++ DFG+AR++    T+  T  VVGT GY+APE++  G+ +  +DV+SFG  + E+  G +
Sbjct:  495 QFDFKAIVAATNNFLPINKLGQGGFGEVYKGTFP-SGVQVAVKRLSKTSGQGEREFENEVVVVAKLQHRNLVRLLGYCLEGEEKILVYEFVHNKSLDYFLFDTTMKRQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKVADFGMARIFGMDQTEANTRRVVGTYGYMAPEYAMYGQFSMKSDVYSFGVLVFEIISGMK 708          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK12_ARATH (Putative cysteine-rich receptor-like protein kinase 12 OS=Arabidopsis thaliana GN=CRK12 PE=2 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 2.663e-49
Identity = 95/214 (44.39%), Postives = 144/214 (67.29%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTD---PQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +K + +AT+ F +   LG GGFG VY+GTL     E+AVK++S  S QG +EF  E+V + +L+HRNLV+LLGYC    E +LVY+++PN SLD +L++  K   L+W +RY +I G+  G+LYLH++    +IHRD+KASN+LLD ++  ++ DFG+AR+   G D     T  + GT GY+ PE+   G+ +  +DV+SFG  +LE+ CG++
Sbjct:  357 FKTIEVATENFAKTNKLGQGGFGEVYKGTLVNGT-EVAVKRLSKTSEQGAQEFKNEVVLVAKLQHRNLVKLLGYCLEPEEKILVYEFVPNKSLDYFLFDPTKQGQLDWTKRYNIIGGITRGILYLHQDSRLTIIHRDLKASNILLDADMIPKIADFGMARI--SGIDQSVANTKRIAGTFGYMPPEYVIHGQFSMKSDVYSFGVLILEIICGKK 567          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK35_ARATH (Putative cysteine-rich receptor-like protein kinase 35 OS=Arabidopsis thaliana GN=CRK35 PE=3 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 3.479e-49
Identity = 93/215 (43.26%), Postives = 146/215 (67.91%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +K +  AT  F +  ++G GGFG VYRG L  S  E+AVK++S  S QG +EF  E V + +L+H+NLV+LLG+C    E +LVY+++PN SLD +L++  K   L+W +RY +I G+A G+LYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR++    +   T  + GT GY++PE++  G  +  +DV+SFG  +LE+  G++
Sbjct:  332 QFSFKTIEAATDKFSDSNMIGRGGFGEVYRGKL-SSGPEVAVKRLSKTSGQGAEEFKNEAVLVSKLQHKNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLFDPAKQGELDWTRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGVDQSQANTRRIAGTFGYMSPEYAMRGHFSMKSDVYSFGVLVLEIISGKK 545          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK7_ARATH (Cysteine-rich receptor-like protein kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.933e-49
Identity = 94/212 (44.34%), Postives = 142/212 (66.98%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            Y+ +  AT  F E   +G GGFG VY+GT      E+AVK++S  S QG  EF  E+V +  LRH+NLV++LG+   + E +LVY+Y+ N SLD +L++  K   L W QRY +I G+A G+LYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR++    T   T+ +VGT GY++PE++  G+ +  +DV+SFG  +LE+  GR+
Sbjct:  326 YRAIQAATNDFSENNKIGRGGFGDVYKGTFSNGT-EVAVKRLSKTSEQGDTEFKNEVVVVANLRHKNLVRILGFSIEREERILVYEYVENKSLDNFLFDPAKKGQLYWTQRYHIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGMDQTQQNTSRIVGTYGYMSPEYAMRGQFSMKSDVYSFGVLVLEIISGRK 536          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK41_ARATH (Cysteine-rich receptor-like protein kinase 41 OS=Arabidopsis thaliana GN=CRK41 PE=2 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 7.749e-49
Identity = 96/214 (44.86%), Postives = 144/214 (67.29%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK-VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ---TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +  + +AT  F     LG GGFG VY+G L   + EIAVK++S +S QG  EF+ E+  + +L+HRNLV+LLG+C +  E +L+Y++  N SLD Y+++  + + L+W  RY +I GVA GLLYLHE+    ++HRD+KASNVLLD  +N ++ DFG+A+L+D     Q   T+ V GT GY+APE++ +G+ +   DVFSFG  +LE+  G++
Sbjct:  334 FDTIRLATNDFSRDNQLGEGGFGAVYKGVLDYGE-EIAVKRLSMKSGQGDNEFINEVSLVAKLQHRNLVRLLGFCLQGEERILIYEFFKNTSLDHYIFDSNRRMILDWETRYRIISGVARGLLYLHEDSRFKIVHRDMKASNVLLDDAMNPKIADFGMAKLFDTDQTSQTRFTSKVAGTYGYMAPEYAMSGEFSVKTDVFSFGVLVLEIIKGKK 546          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK24_ARATH (Cysteine-rich receptor-like protein kinase 24 OS=Arabidopsis thaliana GN=CRK24 PE=2 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 7.749e-49
Identity = 94/215 (43.72%), Postives = 144/215 (66.98%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQ-PKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +K +  AT  F     LG GGFG VY+GT P    E+AVK++S  S QG +EF  E+  + +L+HRNLV+LLGY  +  E +LVY+++PN SLD +L++   K  L+W +RY +I G+  G++YLH++    +IHRD+KA N+LLD ++N ++ DFG+AR +    T+  T  VVGT+GY+ PE+   G+ +T +DV+SFG  +LE+  G++
Sbjct:  299 QFEFKAIEAATCNFHNVNKLGHGGFGEVYKGTFPNGT-EVAVKRLSKTSGQGEEEFKNEVFLVAKLQHRNLVKLLGYAVKGDEKILVYEFLPNKSLDHFLFDPVKKGQLDWTRRYNIINGITRGIVYLHQDSRLTIIHRDLKAGNILLDADMNPKIVDFGVARNFRVDQTEATTARVVGTIGYMPPEYVTNGQFSTKSDVYSFGVLILEIIGGKK 512          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EXS_ARATH3.146e-5046.30Leucine-rich repeat receptor protein kinase EXS OS... [more]
CRK39_ARATH3.146e-5046.98Putative cysteine-rich receptor-like protein kinas... [more]
CRK4_ARATH5.367e-5042.33Cysteine-rich receptor-like protein kinase 4 OS=Ar... [more]
CRK29_ARATH9.154e-5046.73Cysteine-rich receptor-like protein kinase 29 OS=A... [more]
CRK23_ARATH1.196e-4944.65Putative cysteine-rich receptor-like protein kinas... [more]
CRK12_ARATH2.663e-4944.39Putative cysteine-rich receptor-like protein kinas... [more]
CRK35_ARATH3.479e-4943.26Putative cysteine-rich receptor-like protein kinas... [more]
CRK7_ARATH5.933e-4944.34Cysteine-rich receptor-like protein kinase 7 OS=Ar... [more]
CRK41_ARATH7.749e-4944.86Cysteine-rich receptor-like protein kinase 41 OS=A... [more]
CRK24_ARATH7.749e-4943.72Cysteine-rich receptor-like protein kinase 24 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top