FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y1765_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 4.252e-47
Identity = 96/214 (44.86%), Postives = 137/214 (64.02%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP---KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            F  + +  AT  F     +G GGFG VY+G L + K+ IAVK++S +SRQG +EFV EI  I  L+H NLV+L G C    +L+LVY+Y+ N  L + L+ +    ++ L+W  R  +  G+A GL +LHEE    ++HRD+KASNVLLD +LN ++ DFGLA+L D G    +T + GT+GY+APE++  G  T  ADV+SFG   LE+  G+
Sbjct:  666 FTLRQIKAATDNFDVTRKIGEGGFGSVYKGELSEGKL-IAVKQLSAKSRQGNREFVNEIGMISALQHPNLVKLYGCCVEGNQLILVYEYLENNCLSRALFGKDESSRLKLDWSTRKKIFLGIAKGLTFLHEESRIKIVHRDIKASNVLLDKDLNAKISDFGLAKLNDDGNTHISTRIAGTIGYMAPEYAMRGYLTEKADVYSFGVVALEIVSGK 878          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y1743_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 9.473e-47
Identity = 98/220 (44.55%), Postives = 141/220 (64.09%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIV-----SIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            F Y D+  AT  F E+ ++G GG+G VYRG LP  + E+AVKK+  E  +  KEF AE+      + G   H NLV+L G+C    E +LV++YM  GSL++ + ++ K  L W++R  +   VA GL++LH E    ++HRDVKASNVLLD   N R+ DFGLARL + G    +T + GT+GY+APE+ +T +ATT  DV+S+G   +E+A GRR ++
Sbjct:  802 FTYADILKATSNFSEERVVGRGGYGTVYRGVLPDGR-EVAVKKLQREGTEAEKEFRAEMEVLSANAFGDWAHPNLVRLYGWCLDGSEKILVHEYMGGGSLEELITDKTK--LQWKKRIDIATDVARGLVFLHHECYPSIVHRDVKASNVLLDKHGNARVTDFGLARLLNVGDSHVSTVIAGTIGYVAPEYGQTWQATTRGDVYSYGVLTMELATGRRAVD 1018          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y1154_ARATH (Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2)

HSP 1 Score: 186.808 bits (473), Expect = 9.473e-47
Identity = 92/217 (42.40%), Postives = 139/217 (64.06%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQ--PKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            +  ++L  AT G  E+ ++G GG+G VYRG L     ++AVK + +   Q  KEF  E+  IGR+RH+NLV+LLGYC      +LVYD++ NG+L+++++        L W  R  +I G+A GL YLHE  E  V+HRD+K+SN+LLD + N ++ DFGLA+L    +   TT V+GT GY+APE++ TG     +D++SFG  ++E+  GR P++
Sbjct:  142 YTLRELEAATNGLCEENVIGEGGYGIVYRGILTDGT-KVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCVEGAYRMLVYDFVDNGNLEQWIHGDVGDVSPLTWDIRMNIILGMAKGLAYLHEGLEPKVVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTRVMGTFGYVAPEYACTGMLNEKSDIYSFGILIMEIITGRNPVD 357          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: PSKR1_DAUCA (Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.237e-46
Identity = 94/213 (44.13%), Postives = 136/213 (63.85%), Query Frame = 3
Query:   21 DLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQ--PKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            D+  +T  F +  ++G GGFG VY+ TLP    ++A+K++S ++ Q  +EF AE+ ++ R +H NLV LLGYC  K + LL+Y YM NGSLD +L+ +     +L+W+ R  + +G A GL YLH+  E  ++HRD+K+SN+LL       L DFGLARL        TT +VGTLGY+ PE+ +   AT   DV+SFG  LLE+  GRRP++
Sbjct:  735 DILKSTSSFNQANIIGCGGFGLVYKATLPDGT-KVAIKRLSGDTGQMDREFQAEVETLSRAQHPNLVHLLGYCNYKNDKLLIYSYMDNGSLDYWLHEKVDGPPSLDWKTRLRIARGAAEGLAYLHQSCEPHILHRDIKSSNILLSDTFVAHLADFGLARLILPYDTHVTTDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTGRRPMD 946          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: PBS1_ARATH (Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.616e-46
Identity = 95/222 (42.79%), Postives = 138/222 (62.16%), Query Frame = 3
Query:    3 HRFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP--KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ-TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQ 659
            H F +++L  AT  F     LG GGFGRVY+G L  +   +AVK++     QG +EF+ E++ +  L H NLV L+GYC    + LLVY++MP GSL+ +L++ P  K  L+W  R  +  G A GL +LH++    VI+RD K+SN+LLD   + +L DFGLA+L   G     +T V+GT GY APE++ TG+ T  +DV+SFG   LE+  GR+ I+ +
Sbjct:   72 HTFAFRELAAATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSE 293          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5457_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g45780 OS=Arabidopsis thaliana GN=At5g45780 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.110e-46
Identity = 94/219 (42.92%), Postives = 135/219 (61.64%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQ--PKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIER 656
            RF ++++  AT  F  K +LG GGFG VY+G LP   + +AVK++      G  +F  E+  IG   HRNL++L G+C    E +LVY YMPNGS+   L +    K +L+W +R  +  G A GL+YLHE+    +IHRDVKA+N+LLD      +GDFGLA+L D      TT V GT+G++APE+  TG+++   DVF FG  +LE+  G + I++
Sbjct:  287 RFSFREIQTATSNFSPKNILGQGGFGMVYKGYLPNGTV-VAVKRLKDPIYTGEVQFQTEVEMIGLAVHRNLLRLFGFCMTPEERMLVYPYMPNGSVADRLRDNYGEKPSLDWNRRISIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESFEAIVGDFGLAKLLDQRDSHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGVLILELITGHKMIDQ 504          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: BRI1_ARATH (Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.756e-46
Identity = 99/219 (45.21%), Postives = 139/219 (63.47%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK--VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            +  + DL  AT GF    L+GSGGFG VY+  L K    +A+KK+ H S QG +EF+AE+ +IG+++HRNLV LLGYC+   E LLVY++M  GSL+  L++  K  V LNW  R  +  G A GL +LH      +IHRD+K+SNVLLD  L  R+ DFG+ARL     T    + + GT GY+ PE+ ++ + +T  DV+S+G  LLE+  G+RP +
Sbjct:  870 KLTFADLLQATNGFHNDSLIGSGGFGDVYKAIL-KDGSAVAIKKLIHVSGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGDERLLVYEFMKYGSLEDVLHDPKKAGVKLNWSTRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD 1087          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: APK2B_ARATH (Protein kinase 2B, chloroplastic OS=Arabidopsis thaliana GN=APK2B PE=1 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.600e-46
Identity = 101/226 (44.69%), Postives = 139/226 (61.50%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTL---------PKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ-TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIER 656
            F + +L  AT+ FR   LLG GGFG V++G +         P S I +AVKK+  E  QG KE++ E+  +G+L H NLV+L+GYC      LLVY++MP GSL+ +L+ +    L W  R  V  G A GL +LH+   Q VI+RD KA+N+LLD E N +L DFGLA+    G     +T V+GT GY APE+  TG+ T  +DV+SFG  LLE+  GRR +++
Sbjct:   71 FTFNELKNATRNFRPDSLLGEGGFGYVFKGWIDGTTLTASKPGSGIVVAVKKLKTEGYQGHKEWLTEVNYLGQLSHPNLVKLVGYCVEGENRLLVYEFMPKGSLENHLFRRGAQPLTWAIRMKVAIGAAKGLTFLHDAKSQ-VIYRDFKAANILLDAEFNSKLSDFGLAKAGPTGDKTHVSTQVMGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDK 295          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: APK2A_ARATH (Protein kinase 2A, chloroplastic OS=Arabidopsis thaliana GN=APK2A PE=1 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.600e-46
Identity = 101/228 (44.30%), Postives = 140/228 (61.40%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTL---------PKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ-TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQS 662
            F + +L  ATK FR+  LLG GGFG V++G +         P S I +AVK++  E  QG KE++ E+  +G+L H NLV L+GYC      LLVY++MP GSL+ +L+ +    L W  R  V  G A GL +LHE   Q VI+RD KA+N+LLD + N +L DFGLA+    G +   +T V+GT GY APE+  TG+ T  +DV+SFG  LLE+  GRR ++  +
Sbjct:   74 FTFNELKNATKNFRQDNLLGEGGFGCVFKGWIDQTSLTASRPGSGIVVAVKQLKPEGFQGHKEWLTEVNYLGQLSHPNLVLLVGYCAEGENRLLVYEFMPKGSLENHLFRRGAQPLTWAIRMKVAVGAAKGLTFLHEAKSQ-VIYRDFKAANILLDADFNAKLSDFGLAKAGPTGDNTHVSTKVIGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELISGRRAMDNSN 300          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5343_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.701e-46
Identity = 98/213 (46.01%), Postives = 134/213 (62.91%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK--VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            F  K +  AT  F  +  +G GGFG VY+G L    + IAVK++S +S+QG +EFV EI  I  L+H NLV+L G C    ELLLVY+Y+ N SL + L+   K  + L+W  R  +  G+A GL YLHEE    ++HRD+KA+NVLLD  LN ++ DFGLA+L D      +T + GT+GY+APE++  G  T  ADV+SFG   LE+  G+
Sbjct:  657 FTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADG-MTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGK 868          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
Y1765_ARATH4.252e-4744.86Probable LRR receptor-like serine/threonine-protei... [more]
Y1743_ARATH9.473e-4744.55Probable LRR receptor-like serine/threonine-protei... [more]
Y1154_ARATH9.473e-4742.40Probable serine/threonine-protein kinase At1g01540... [more]
PSKR1_DAUCA1.237e-4644.13Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR... [more]
PBS1_ARATH1.616e-4642.79Serine/threonine-protein kinase PBS1 OS=Arabidopsi... [more]
Y5457_ARATH2.110e-4642.92Probable LRR receptor-like serine/threonine-protei... [more]
BRI1_ARATH2.756e-4645.21Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidops... [more]
APK2B_ARATH3.600e-4644.69Protein kinase 2B, chloroplastic OS=Arabidopsis th... [more]
APK2A_ARATH3.600e-4644.30Protein kinase 2A, chloroplastic OS=Arabidopsis th... [more]
Y5343_ARATH4.701e-4646.01Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top