FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: RIPK2_HUMAN (Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens GN=RIPK2 PE=1 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 56/208 (26.92%), Postives = 103/208 (49.52%), Query Frame = 3
Query:   63 LGSGGFGRVYRGTLPKSKIEIAVKKISHESR---QGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLAR----LYDHGTDPQTTHVVGTLGYLAPEHSRTG---KATTSADVFSFGAFLLEVACGRRPIE 653
            L  G  G V        ++++AVK +   +       K+ + E   + + R   ++ +LG C     L +V +YMPNGSL++ L+ + +   + W  R+ ++  +ALG+ YLH      ++H D+K  N+LLD E + ++ DFGL++            ++    GT+ Y+ PE+   G   +A+   D++S+     EV   ++P E
Sbjct:   24 LSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHN-MTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFE 230          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: PTK6_MOUSE (Protein-tyrosine kinase 6 OS=Mus musculus GN=Ptk6 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 62/189 (32.80%), Postives = 95/189 (50.26%), Query Frame = 3
Query:   63 LGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEV 629
            LG+G FG V+   L K ++ +AVK IS ++      F AEI ++ +LRH++++ L         + ++ + MP G+L + L +  +  L   +       VA G+ YL     Q  IHRD+ A NVL+      ++GDFGLARL          H V    + APE    G  +  +DV+SFG  L E+
Sbjct:  197 LGAGYFGEVFEA-LWKGQVHVAVKVISRDNLLHQHTFQAEIQAMKKLRHKHILSLYAVATAGDPVYIITELMPKGNLLQLLRDSDEKALPILELVDFASQVAEGMCYLE---SQNYIHRDLAARNVLVTENNLCKVGDFGLARLVKEDIYLSHEHNV-PYKWTAPEALSRGHYSIKSDVWSFGVLLHEI 380          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: PTK6_HUMAN (Protein-tyrosine kinase 6 OS=Homo sapiens GN=PTK6 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 60/189 (31.75%), Postives = 98/189 (51.85%), Query Frame = 3
Query:   63 LGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEV 629
            LGSG FG V+ G L K ++++A+K IS ++    +   +EI ++ +LRH++++ L         + ++ + M  GSL + L +  +  L   +   +   VA G+ YL     Q  IHRD+ A N+L+      ++GDFGLARL          H +    + APE    G  +T +DV+SFG  L E+
Sbjct:  197 LGSGYFGEVFEG-LWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLE---SQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNI-PYKWTAPEALSRGHYSTKSDVWSFGILLHEM 380          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: PKNK_MYCBO (Probable serine/threonine-protein kinase pknK OS=Mycobacterium bovis GN=pknK PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 69/214 (32.24%), Postives = 103/214 (48.13%), Query Frame = 3
Query:   42 GFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHE-SRQGMKEFVAEIVSIGRLR-HRNLVQLLGY-CRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQSQKRI 674
            GF   E +G GGFG VYR   P     +AVK +S +  R  ++ F+ E  ++GRL  H ++V +L       G   +V  Y    SL+  +       L+WR+   +   +A  L   H       +HRDVK  N+LL      +L DFG+AR+   G +  T  + G+  + APE       T ++DV+S GA L  V  G    ER+S +R+
Sbjct:   25 GFDNVEEIGRGGFGVVYRCVQPSLDRAVAVKVLSTDLDRDNLERFLREQRAMGRLSGHPHIVTVLQVGVLAGGRPFIVMPYHAKNSLETLIRRHGP--LDWRETLSIGVKLAGALEAAHRVG---TLHRDVKPGNILLTDYGEPQLTDFGIARIAG-GFETATGVIAGSPAFTAPEVLEGASPTPASDVYSLGATLFCVLTGHAAYERRSGERV 232          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: M3K1_HUMAN (Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 67/209 (32.06%), Postives = 102/209 (48.80%), Query Frame = 3
Query:   63 LGSGGFGRVYR------GTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGS----LDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNG-RLGDFGLA-RLYDHGTDPQTTH--VVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRP 647
            +G G F   Y+      GTL   K    V+  S E  + ++    EI  +  L H N++++LG    K    L  ++M  GS    L KY   +  V +N+ ++      +  GL YLHE     +IHRDVK +N+L+D      R+ DFG A RL   GT        ++GT+ ++APE  R  +   S DV+S G  ++E+AC + P
Sbjct: 1249 IGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQ------LLRGLSYLHENQ---IIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPP 1448          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: LCK_HUMAN (Proto-oncogene tyrosine-protein kinase LCK OS=Homo sapiens GN=LCK PE=1 SV=6)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 61/198 (30.81%), Postives = 101/198 (51.01%), Query Frame = 3
Query:   57 ELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVAC-GRRP 647
            E LG+G FG V+ G       ++AVK +   S      F+AE   + +L+H+ LV+L     ++  + ++ +YM NGSL  +L     + L   +   +   +A G+ ++ E   +  IHRD++A+N+L+   L+ ++ DFGLARL +             + + APE    G  T  +DV+SFG  L E+   GR P
Sbjct:  249 ERLGAGQFGEVWMGYY-NGHTKVAVKSLKQGS-MSPDAFLAEANLMKQLQHQRLVRLYAVVTQE-PIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEE---RNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIP 440          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: LCK_AOTNA (Proto-oncogene tyrosine-protein kinase LCK OS=Aotus nancymaae GN=LCK PE=2 SV=4)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 61/198 (30.81%), Postives = 101/198 (51.01%), Query Frame = 3
Query:   57 ELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVAC-GRRP 647
            E LG+G FG V+ G       ++AVK +   S      F+AE   + +L+H+ LV+L     ++  + ++ +YM NGSL  +L     + L   +   +   +A G+ ++ E   +  IHRD++A+N+L+   L+ ++ DFGLARL +             + + APE    G  T  +DV+SFG  L E+   GR P
Sbjct:  249 ERLGAGQFGEVWMGYY-NDHTKVAVKSLKQGS-MSPDAFLAEANLMKQLQHQRLVRLYAVVTQE-PIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEE---RNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIP 440          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: KRAF1_CAEBR (Raf homolog serine/threonine-protein kinase OS=Caenorhabditis briggsae GN=lin-45 PE=3 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 64/222 (28.83%), Postives = 113/222 (50.90%), Query Frame = 3
Query:   12 RYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKIS--HESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLY-NQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNV-LLDGELNGRLGDFGLARLYDHGT---DPQTTHVVGTLGYLAPEHSR---TGKATTSADVFSFGAFLLEVACGRRP 647
            +++D  I    F     +GSG FG VYRG    +   +A+KK++    +   M  F  E+  + + RH N++  +G+  R+ E+ ++  +    SL ++++  +P+V         ++K V+LG+ YLH    + +IHRD+K +N+ L+D     ++GDFGLA +    T     Q     G++ ++APE  R       T  +DV+SFG  + E+     P
Sbjct:  468 QHEDWEILPNEFVIHYKVGSGSFGTVYRGEFFGT---VAIKKLNVVDPTPSQMAAFKNEVAVLKKTRHLNVLLFMGWV-REPEIAIITQWCEGSSLYRHIHVQEPRVEFEMSAVIDILKQVSLGMNYLH---SKNIIHRDLKTNNIFLMDDMSTVKIGDFGLATVKTKWTVNGGQQQQQPTGSILWMAPEVIRMQDDNPYTPQSDVYSFGVCMYEILSSHLP 682          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: IKKB_HUMAN (Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Homo sapiens GN=IKBKB PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 75/210 (35.71%), Postives = 102/210 (48.57%), Query Frame = 3
Query:   54 KELLGSGGFGRVYRGTLPKSKIEIAVKKISHE-SRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGEL------LLVYDYMPNGSLDKYLYNQPKVTLNWRQR--YGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLD-GE--LNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRP 647
            KE LG+GGFG V R    ++  +IA+K+   E S +  + +  EI  + RL H N+V           L      LL  +Y   G L KYL NQ +     R+     ++  +A  L YLHE     +IHRD+K  N++L  GE  L  ++ D G A+  D G+    T  VGTL YLAPE     K T + D +SFG    E   G RP
Sbjct:   18 KERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYL-NQFENCCGLREGAILTLLSDIASALRYLHENR---IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGS--LCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRP 221          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: IKKA_DANRE (Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.742e-16
Identity = 71/210 (33.81%), Postives = 98/210 (46.67%), Query Frame = 3
Query:   54 KELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSI-GRLRHRNLVQLLGYCRRKGEL------LLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLG----DFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRP 647
            KE LG+GGFG VY     ++  +IAVK    E     K+  +  + I  +L+H N+V           +      LL  +Y   G L K L        L   +   ++  V  G+ YLHE     +IHRD+K  N++L  E+NG+L     D G A+  D G+    T  VGTL YLAPE       T + D +SFG  + E  CG RP
Sbjct:   18 KERLGTGGFGHVYLYQNQETSEKIAVKLCRLELNSKNKDRWSRGIQIMKKLKHLNVVTAKDVPEEMMHIALNDLPLLAMEYCSKGDLRKLLSKPENCCGLKESEVLSLLNDVGSGIQYLHEN---KIIHRDLKPENIVLQ-EINGKLVHKIIDLGYAKDLDQGS--LCTSFVGTLQYLAPELFEGKSYTVTVDFWSFGTMIFECCCGFRP 221          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RIPK2_HUMAN1.742e-1626.92Receptor-interacting serine/threonine-protein kina... [more]
PTK6_MOUSE1.742e-1632.80Protein-tyrosine kinase 6 OS=Mus musculus GN=Ptk6 ... [more]
PTK6_HUMAN1.742e-1631.75Protein-tyrosine kinase 6 OS=Homo sapiens GN=PTK6 ... [more]
PKNK_MYCBO1.742e-1632.24Probable serine/threonine-protein kinase pknK OS=M... [more]
M3K1_HUMAN1.742e-1632.06Mitogen-activated protein kinase kinase kinase 1 O... [more]
LCK_HUMAN1.742e-1630.81Proto-oncogene tyrosine-protein kinase LCK OS=Homo... [more]
LCK_AOTNA1.742e-1630.81Proto-oncogene tyrosine-protein kinase LCK OS=Aotu... [more]
KRAF1_CAEBR1.742e-1628.83Raf homolog serine/threonine-protein kinase OS=Cae... [more]
IKKB_HUMAN1.742e-1635.71Inhibitor of nuclear factor kappa-B kinase subunit... [more]
IKKA_DANRE1.742e-1633.81Inhibitor of nuclear factor kappa-B kinase subunit... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top