FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: THE1_ARATH (Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.701e-46
Identity = 99/215 (46.05%), Postives = 134/215 (62.33%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTH----VVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            F ++++  AT  F E  LLG GGFGRVY+GTL +   ++AVK+ +  S QGM EF  EI  + +LRHR+LV L+GYC  + E++LVY+YM NG L  +LY      L+W+QR  +  G A GL YLH    Q +IHRDVK +N+LLD  L  ++ DFGL++    G     TH    V G+ GYL PE+ R  + T  +DV+SFG  L+EV C R
Sbjct:  498 FMFQEIMDATNKFDESSLLGVGGFGRVYKGTL-EDGTKVAVKRGNPRSEQGMAEFRTEIEMLSKLRHRHLVSLIGYCDERSEMILVYEYMANGPLRSHLYGADLPPLSWKQRLEICIGAARGLHYLHTGASQSIIHRDVKTTNILLDENLVAKVADFGLSKT---GPSLDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCCR 708          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: SRK6_BRAOE (Putative serine/threonine-protein kinase receptor OS=Brassica oleracea var. acephala GN=SRK6 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.701e-46
Identity = 95/206 (46.12%), Postives = 137/206 (66.50%), Query Frame = 3
Query:   33 ATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHG-TDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            AT+ F     LG GGFG VY+G L   K EIAVK++S  S QG  EF+ E+  I RL+H NLVQ+LG C    E +L+Y+Y+ N SLD YL+ + + + LNW +R+ +  GVA GLLYLH++    +IHRD+K SN+LLD  +  ++ DFG+AR+++   T+  T  VVGT GY++PE++  G  +  +DVFSFG  +LE+  G++
Sbjct:  524 ATENFSSCNKLGQGGFGIVYKGRLLDGK-EIAVKRLSKTSVQGTDEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRRSKLNWNERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMYGIFSEKSDVFSFGVIVLEIVSGKK 728          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK33_ARATH (Putative cysteine-rich receptor-like protein kinase 33 OS=Arabidopsis thaliana GN=CRK33 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.701e-46
Identity = 94/215 (43.72%), Postives = 142/215 (66.05%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            ++  K +  AT  F +  +LG GGFG V++G L     EIAVK++S ES QG++EF  E   + +L+HRNLV +LG+C    E +LVY+++PN SLD++L+   K   L+W +RY +I G A G+LYLH +    +IHRD+KASN+LLD E+  ++ DFG+AR++    +   T  VVGT GY++PE+   G+ +  +DV+SFG  +LE+  G+R
Sbjct:  308 QYDLKTIEAATCTFSKCNMLGQGGFGEVFKGVLQDGS-EIAVKRLSKESAQGVQEFQNETSLVAKLQHRNLVGVLGFCMEGEEKILVYEFVPNKSLDQFLFEPTKKGQLDWAKRYKIIVGTARGILYLHHDSPLKIIHRDLKASNILLDAEMEPKVADFGMARIFRVDQSRADTRRVVGTHGYISPEYLMHGQFSVKSDVYSFGVLVLEIISGKR 521          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK11_ARATH (Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana GN=CRK11 PE=2 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 4.701e-46
Identity = 88/214 (41.12%), Postives = 143/214 (66.82%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            + +K +  AT  F     LG GGFG VY+G L     ++AVK++S +S QG +EF  E V + +L+HRNLV+LLG+C  + E +L+Y+++ N SLD +L++  K + L+W +RY +I G+A G+LYLH++    +IHRD+KASN+LLD ++N ++ DFGLA ++    T   T  + GT  Y++PE++  G+ +  +D++SFG  +LE+  G++
Sbjct:  338 YDFKTIEAATNKFSTSNKLGEGGFGAVYKGKLSNGT-DVAVKRLSKKSGQGTREFRNEAVLVTKLQHRNLVRLLGFCLEREEQILIYEFVHNKSLDYFLFDPEKQSQLDWTRRYKIIGGIARGILYLHQDSRLKIIHRDLKASNILLDADMNPKIADFGLATIFGVEQTQGNTNRIAGTYAYMSPEYAMHGQYSMKSDIYSFGVLVLEIISGKK 550          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: PSKR2_ARATH (Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 6.140e-46
Identity = 97/214 (45.33%), Postives = 135/214 (63.08%), Query Frame = 3
Query:   18 KDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP--KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            ++L  +T  F +  ++G GGFG VY+   P    + AVK++S +  Q  +EF AE+ ++ R  H+NLV L GYC+   + LL+Y +M NGSLD +L+ +    +TL W  R  + +G A GL YLH+  E  VIHRDVK+SN+LLD +    L DFGLARL        TT +VGTLGY+ PE+S++  AT   DV+SFG  LLE+  GRRP+E
Sbjct:  745 EELLKSTNNFSQANIIGCGGFGLVYKANFPDGS-KAAVKRLSGDCGQMEREFQAEVEALSRAEHKNLVSLQGYCKHGNDRLLIYSFMENGSLDYWLHERVDGNMTLIWDVRLKIAQGAARGLAYLHKVCEPNVIHRDVKSSNILLDEKFEAHLADFGLARLLRPYDTHVTTDLVGTLGYIPPEYSQSLIATCRGDVYSFGVVLLELVTGRRPVE 957          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: BRI1_SOLPE (Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 6.140e-46
Identity = 97/219 (44.29%), Postives = 139/219 (63.47%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK--VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            +  + DL  AT GF    L+GSGGFG VY+  L    + +A+KK+ H S QG +EF AE+ +IG+++HRNLV LLGYC+   E LLVY+YM  GSL+  L+++ K  + LNW  R  +  G A GL +LH      +IHRD+K+SNVLLD  L  R+ DFG+ARL     T    + + GT GY+ PE+ ++ + +T  DV+S+G  LLE+  G++P +
Sbjct:  875 KLTFADLLEATNGFHNDSLVGSGGFGDVYKAQLKDGSV-VAIKKLIHVSGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKYGSLEDVLHDRKKTGIKLNWPARRKIAIGAARGLAFLHHNCIPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKQPTD 1092          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 6.140e-46
Identity = 97/219 (44.29%), Postives = 139/219 (63.47%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK--VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            +  + DL  AT GF    L+GSGGFG VY+  L    + +A+KK+ H S QG +EF AE+ +IG+++HRNLV LLGYC+   E LLVY+YM  GSL+  L+++ K  + LNW  R  +  G A GL +LH      +IHRD+K+SNVLLD  L  R+ DFG+ARL     T    + + GT GY+ PE+ ++ + +T  DV+S+G  LLE+  G++P +
Sbjct:  875 KLTFADLLEATNGFHNDSLVGSGGFGDVYKAQLKDGSV-VAIKKLIHVSGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKYGSLEDVLHDRKKIGIKLNWPARRKIAIGAARGLAFLHHNCIPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKQPTD 1092          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y1534_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 8.019e-46
Identity = 101/226 (44.69%), Postives = 139/226 (61.50%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYN--QPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR-RPIERQSQKRIY 677
            F  + + IAT  F     +G GGFG VY+G L    I IAVK++S  S+QG +EF+ EI  I  L H NLV+L G C   G+LLLVY+++ N SL + L+   + ++ L+W  R  +  GVA GL YLHEE    ++HRD+KA+NVLLD +LN ++ DFGLA+L +  +   +T + GT GY+APE++  G  T  ADV+SFG   LE+  GR   IER      Y
Sbjct:  612 FSLRQIKIATNNFDSANRIGEGGFGPVYKGKLFDGTI-IAVKQLSTGSKQGNREFLNEIGMISALHHPNLVKLYGCCVEGGQLLLVYEFVENNSLARALFGPQETQLRLDWPTRRKICIGVARGLAYLHEESRLKIVHRDIKATNVLLDKQLNPKISDFGLAKLDEEDSTHISTRIAGTFGYMAPEYAMRGHLTDKADVYSFGIVALEIVHGRSNKIERSKNNTFY 836          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5344_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 1.047e-45
Identity = 98/213 (46.01%), Postives = 134/213 (62.91%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK--VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            F  K +  AT  F  +  +G GGFG VY+G L    + IAVK++S +S+QG +EFV EI  I  L+H NLV+L G C    ELLLVY+Y+ N SL + L+   K  + L+W  R  V  G+A GL YLHEE    ++HRD+KA+NVLLD  LN ++ DFGLA+L +      +T + GT+GY+APE++  G  T  ADV+SFG   LE+  G+
Sbjct:  655 FTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADG-MTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGK 866          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y2239_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g23950 OS=Arabidopsis thaliana GN=At2g23950 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.047e-45
Identity = 96/216 (44.44%), Postives = 133/216 (61.57%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISH-ESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            F +++L++AT GF  K +LG+GGFG VYRG      + +AVK++       G  +F  E+  I    HRNL++L+GYC    E LLVY YM NGS+   L  +P   L+W  R  +  G A GL YLHE+ +  +IHRDVKA+N+LLD      +GDFGLA+L +H     TT V GT+G++APE+  TG+++   DVF FG  LLE+  G R +E
Sbjct:  287 FTFRELHVATDGFSSKSILGAGGFGNVYRGKFGDGTV-VAVKRLKDVNGTSGNSQFRTELEMISLAVHRNLLRLIGYCASSSERLLVYPYMSNGSVASRLKAKP--ALDWNTRKKIAIGAARGLFYLHEQCDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLNHEDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRALE 499          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
THE1_ARATH4.701e-4646.05Receptor-like protein kinase THESEUS 1 OS=Arabidop... [more]
SRK6_BRAOE4.701e-4646.12Putative serine/threonine-protein kinase receptor ... [more]
CRK33_ARATH4.701e-4643.72Putative cysteine-rich receptor-like protein kinas... [more]
CRK11_ARATH4.701e-4641.12Cysteine-rich receptor-like protein kinase 11 OS=A... [more]
PSKR2_ARATH6.140e-4645.33Phytosulfokine receptor 2 OS=Arabidopsis thaliana ... [more]
BRI1_SOLPE6.140e-4644.29Systemin receptor SR160 OS=Solanum peruvianum PE=1... [more]
BRI1_SOLLC6.140e-4644.29Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]
Y1534_ARATH8.019e-4644.69Probable LRR receptor-like serine/threonine-protei... [more]
Y5344_ARATH1.047e-4546.01Probable LRR receptor-like serine/threonine-protei... [more]
Y2239_ARATH1.047e-4544.44Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top