FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK2_ARATH (Cysteine-rich receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.368e-45
Identity = 93/213 (43.66%), Postives = 136/213 (63.85%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK-VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            F+Y  L  AT  F     LG GGFG VY+G LP  + +IAVK++   +R    +F  E+  I  + H+NLV+LLG      E LLVY+Y+ N SLD+++++  +  TL+W++RY +I G A GL+YLHE+    +IHRD+KASN+LLD +L  ++ DFGLAR +       +T + GTLGY+APE+   G+ T   DV+SFG  +LE+  G++
Sbjct:  313 FKYSTLEKATGSFDNANKLGQGGFGTVYKGVLPDGR-DIAVKRLFFNNRHRATDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRYTIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDKSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQ 524          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5977_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.333e-45
Identity = 95/222 (42.79%), Postives = 140/222 (63.06%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ----TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQS 662
            F +++L   T  F +   +G GG+G+VY+GTLP  ++ IA+K+    S QG  EF  EI  + R+ H+N+V+LLG+C  + E +LVY+Y+PNGSL   L  +  V L+W +R  +  G   GL YLHE  +  +IHRDVK++N+LLD  L  ++ DFGL++L     DP+    TT V GT+GYL PE+  T + T  +DV+ FG  +LE+  G+ PI+R S
Sbjct:  622 FTFEELSKCTNNFSDANDVGGGGYGQVYKGTLPNGQV-IAIKRAQQGSMQGAFEFKTEIELLSRVHHKNVVKLLGFCFDQKEQMLVYEYIPNGSLRDGLSGKNGVKLDWTRRLKIALGSGKGLAYLHELADPPIIHRDVKSNNILLDEHLTAKVADFGLSKLVG---DPEKAHVTTQVKGTMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGS 839          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK17_ARATH (Cysteine-rich receptor-like protein kinase 17 OS=Arabidopsis thaliana GN=CRK17 PE=2 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 2.333e-45
Identity = 95/215 (44.19%), Postives = 141/215 (65.58%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F  K +  AT  F E   LG+GGFG VY+G L     EIAVK++S  S QG  EF  E+V + +L+H NLV+LLG+  +  E LLVY+++PN SLD +L++  K   L+W  R  +I G+  G+LYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR++    T   T  VVGT GY++PE+   G+ +  +DV+SFG  +LE+  G++
Sbjct:  346 QFDLKTIEAATGNFSEHNKLGAGGFGEVYKGMLLNGT-EIAVKRLSKTSGQGEIEFKNEVVVVAKLQHINLVRLLGFSLQGEEKLLVYEFVPNKSLDYFLFDPNKRNQLDWTVRRNIIGGITRGILYLHQDSRLKIIHRDLKASNILLDADMNPKIADFGMARIFGVDQTVANTARVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKK 559          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y4391_ARATH (Probable receptor-like protein kinase At4g39110 OS=Arabidopsis thaliana GN=At4g39110 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.047e-45
Identity = 95/217 (43.78%), Postives = 132/217 (60.83%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQ 659
            F   +L  ATK F   +++G GGFG VY GTL     ++AVK+ + +S QG+ EF  EI  + +LRHR+LV L+GYC    E++LVY++M NG    +LY +    L W+QR  +  G A GL YLH    Q +IHRDVK++N+LLD  L  ++ DFGL++    G +  +T V G+ GYL PE+ R  + T  +DV+SFG  LLE  C R  I  Q
Sbjct:  514 FSLSELQEATKNFEASQIIGVGGFGNVYIGTLDDGT-KVAVKRGNPQSEQGITEFQTEIQMLSKLRHRHLVSLIGYCDENSEMILVYEFMSNGPFRDHLYGKNLAPLTWKQRLEICIGSARGLHYLHTGTAQGIIHRDVKSTNILLDEALVAKVADFGLSKDVAFGQNHVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLLEALCARPAINPQ 729          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: RLCK7_ARATH (Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.980e-45
Identity = 91/224 (40.62%), Postives = 140/224 (62.50%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP--KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ-TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQSQKR 671
            F +++L  AT  FR    LG GGFG+V++GT+ K    +A+K++     QG++EFV E++++    H NLV+L+G+C    + LLVY+YMP GSL+ +L+  P  K  L+W  R  +  G A GL YLH+     VI+RD+K SN+LL  +   +L DFGLA++   G     +T V+GT GY AP+++ TG+ T  +D++SFG  LLE+  GR+ I+    ++
Sbjct:   91 FTFQELAEATGNFRSDCFLGEGGFGKVFKGTIEKLDQVVAIKQLDRNGVQGIREFVVEVLTLSLADHPNLVKLIGFCAEGDQRLLVYEYMPQGSLEDHLHVLPSGKKPLDWNTRMKIAAGAARGLEYLHDRMTPPVIYRDLKCSNILLGEDYQPKLSDFGLAKVGPSGDKTHVSTRVMGTYGYCAPDYAMTGQLTFKSDIYSFGVVLLELITGRKAIDNTKTRK 314          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK18_ARATH (Cysteine-rich receptor-like protein kinase 18 OS=Arabidopsis thaliana GN=CRK18 PE=2 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 3.980e-45
Identity = 94/215 (43.72%), Postives = 140/215 (65.12%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F  K +  AT  F E+  LG GGFG VY+G L     EIAVK++S  S QG  EF  E+V + +L+H NLV+LLG+  +  E LLVY+++ N SLD +L++  K   L+W  R  +I G+  G+LYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR++    T   T  VVGT GY++PE+   G+ +  +DV+SFG  +LE+  G++
Sbjct:  326 QFDLKTIESATSNFSERNKLGKGGFGEVYKGMLMNGT-EIAVKRLSKTSGQGEVEFKNEVVVVAKLQHINLVRLLGFSLQGEEKLLVYEFVSNKSLDYFLFDPTKRNQLDWTMRRNIIGGITRGILYLHQDSRLKIIHRDLKASNILLDADMNPKIADFGMARIFGVDQTVANTGRVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKK 539          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5374_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.198e-45
Identity = 98/219 (44.75%), Postives = 136/219 (62.10%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARL--YDHG---TDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPI 650
            + + +L  AT  F +   +G GG+G+VY+G LP   + +AVK+    S QG KEF  EI  + RL HRNLV LLGYC +KGE +LVY+YMPNGSL   L  + +  L+   R  +  G A G+LYLH E +  +IHRD+K SN+LLD ++N ++ DFG+++L   D G    D  TT V GT GY+ PE+  + + T  +DV+S G   LE+  G RPI
Sbjct:  619 YNFTELDSATSSFSDLSQIGRGGYGKVYKGHLPGGLV-VAVKRAEQGSLQGQKEFFTEIELLSRLHHRNLVSLLGYCDQKGEQMLVYEYMPNGSLQDALSARFRQPLSLALRLRIALGSARGILYLHTEADPPIIHRDIKPSNILLDSKMNPKVADFGISKLIALDGGGVQRDHVTTIVKGTPGYVDPEYYLSHRLTEKSDVYSLGIVFLEILTGMRPI 836          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y2214_ARATH (Probable receptor-like protein kinase At2g21480 OS=Arabidopsis thaliana GN=At2g21480 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.198e-45
Identity = 94/217 (43.32%), Postives = 131/217 (60.37%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQ 659
            F   +L   TK F   E++G GGFG VY GT+     ++A+K+ + +S QG+ EF  EI  + +LRHR+LV L+GYC    E++LVY+YM NG    +LY +    L W+QR  +  G A GL YLH    Q +IHRDVK++N+LLD  L  ++ DFGL++    G +  +T V G+ GYL PE+ R  + T  +DV+SFG  LLE  C R  I  Q
Sbjct:  513 FSLSELQEVTKNFDASEIIGVGGFGNVYIGTIDDGT-QVAIKRGNPQSEQGITEFHTEIQMLSKLRHRHLVSLIGYCDENAEMILVYEYMSNGPFRDHLYGKNLSPLTWKQRLEICIGAARGLHYLHTGTAQGIIHRDVKSTNILLDEALVAKVADFGLSKDVAFGQNHVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLLEALCARPAINPQ 728          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y1105_ARATH (Probable receptor-like protein kinase At1g11050 OS=Arabidopsis thaliana GN=At1g11050 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.198e-45
Identity = 97/222 (43.69%), Postives = 135/222 (60.81%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCR----RKGELLLVYDYMPNGSLDKYLYNQPKVT---LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            F+ ++L  AT  F +K  +G GGFG VY+G LP   + IAVKK+     QG  EF  E+  I  L+HRNLV L G        + +  LVYDYM NG+LD +L+ + + T   L+W QR  +I  VA GL YLH   +  + HRD+K +N+LLD ++  R+ DFGLA+    G    TT V GT GYLAPE++  G+ T  +DV+SFG  +LE+ CGR+ ++
Sbjct:  283 FKIEELEKATNNFSQKNFIGRGGFGFVYKGVLPDGSV-IAVKKVIESEFQGDAEFRNEVEIISNLKHRNLVPLRGCSMVDDDSESQRYLVYDYMSNGNLDDHLFPRGETTKMPLSWPQRKSIILDVAKGLAYLHYGVKPAIYHRDIKGTNILLDVDMRARVADFGLAKQSREGESHLTTRVAGTHGYLAPEYALYGQLTEKSDVYSFGVVILEIMCGRKALD 503          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: SERK4_ARATH (Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2)

HSP 1 Score: 179.874 bits (455), Expect = 1.158e-44
Identity = 94/219 (42.92%), Postives = 137/219 (62.56%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMK-EFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK--VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            RF  ++L +AT  F  K +LG GGFG+VY+G L    + +AVK++  E  +G + +F  E+  I    HRNL++L G+C    E LLVY YM NGS+   L  +P+    L+W +R  +  G A GL YLH+  +Q +IHRDVKA+N+LLD E    +GDFGLA+L ++     TT V GT+G++APE+  TGK++   DVF +G  LLE+  G++  +
Sbjct:  281 RFTLRELLVATDNFSNKNVLGRGGFGKVYKGRLADGNL-VAVKRLKEERTKGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKIIHRDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFD 498          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CRK2_ARATH1.368e-4543.66Cysteine-rich receptor-like protein kinase 2 OS=Ar... [more]
Y5977_ARATH2.333e-4542.79Probable leucine-rich repeat receptor-like protein... [more]
CRK17_ARATH2.333e-4544.19Cysteine-rich receptor-like protein kinase 17 OS=A... [more]
Y4391_ARATH3.047e-4543.78Probable receptor-like protein kinase At4g39110 OS... [more]
RLCK7_ARATH3.980e-4540.63Probable serine/threonine-protein kinase RLCKVII O... [more]
CRK18_ARATH3.980e-4543.72Cysteine-rich receptor-like protein kinase 18 OS=A... [more]
Y5374_ARATH5.198e-4544.75Probable LRR receptor-like serine/threonine-protei... [more]
Y2214_ARATH5.198e-4543.32Probable receptor-like protein kinase At2g21480 OS... [more]
Y1105_ARATH5.198e-4543.69Probable receptor-like protein kinase At1g11050 OS... [more]
SERK4_ARATH1.158e-4442.92Somatic embryogenesis receptor kinase 4 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top