FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: RKF1_ARATH (Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.158e-44
Identity = 90/212 (42.45%), Postives = 136/212 (64.15%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYN--QPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACG 638
            F  + +  AT  F     +G GGFG V++G L   ++ +AVK++S +SRQG +EF+ EI +I  L+H NLV+L G+C  + +LLL Y+YM N SL   L++    ++ ++W  R+ +  G+A GL +LHEE     +HRD+KA+N+LLD +L  ++ DFGLARL +      +T V GT+GY+APE++  G  T  ADV+SFG  +LE+  G
Sbjct:  669 FTLRQIKFATDDFNPTNKIGEGGFGAVFKGVLADGRV-VAVKQLSSKSRQGNREFLNEIGAISCLQHPNLVKLHGFCVERAQLLLAYEYMENNSLSSALFSPKHKQIPMDWPTRFKICCGIAKGLAFLHEESPLKFVHRDIKATNILLDKDLTPKISDFGLARLDEEEKTHISTKVAGTIGYMAPEYALWGYLTFKADVYSFGVLVLEIVAG 879          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: PSYR1_ARATH (Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.158e-44
Identity = 93/223 (41.70%), Postives = 136/223 (60.99%), Query Frame = 3
Query:    6 RFRYKDLYI-----ATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK--VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            R+  KDL I     AT  F +  ++G GGFG VY+ TL     ++AVKK++ +     KEF AE+  + R +H NLV L GYC      +L+Y +M NGSLD +L+  P+    L+W +R  +++G + GL Y+H+  E  ++HRD+K+SN+LLDG     + DFGL+RL        TT +VGTLGY+ PE+ +   AT   DV+SFG  +LE+  G+RP+E
Sbjct:  785 RYEVKDLTIFELLKATDNFSQANIIGCGGFGLVYKATLDNGT-KLAVKKLTGDYGMMEKEFKAEVEVLSRAKHENLVALQGYCVHDSARILIYSFMENGSLDYWLHENPEGPAQLDWPKRLNIMRGASSGLAYMHQICEPHIVHRDIKSSNILLDGNFKAYVADFGLSRLILPYRTHVTTELVGTLGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPME 1006          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: BAK1_ARATH (BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2)

HSP 1 Score: 179.489 bits (454), Expect = 1.512e-44
Identity = 95/219 (43.38%), Postives = 136/219 (62.10%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMK-EFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT--LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            RF  ++L +A+  F  K +LG GGFG+VY+G L    + +AVK++  E  QG + +F  E+  I    HRNL++L G+C    E LLVY YM NGS+   L  +P+    L+W +R  +  G A GL YLH+  +  +IHRDVKA+N+LLD E    +GDFGLA+L D+     TT V GT+G++APE+  TGK++   DVF +G  LLE+  G+R  +
Sbjct:  276 RFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTL-VAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFD 493          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y1684_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g06840 OS=Arabidopsis thaliana GN=At1g06840 PE=1 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 1.975e-44
Identity = 97/220 (44.09%), Postives = 133/220 (60.45%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD----HGTDPQ--TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPI 650
            F Y +L +AT  F     +G GG+G+VY+GTL    + +A+K+    S QG KEF+ EI  + RL HRNLV LLG+C  +GE +LVY+YM NG+L   +  + K  L++  R  +  G A G+LYLH E    + HRD+KASN+LLD     ++ DFGL+RL       G  PQ  +T V GT GYL PE+  T + T  +DV+S G  LLE+  G +PI
Sbjct:  613 FTYAELALATDNFNSSTQIGQGGYGKVYKGTLGSGTV-VAIKRAQEGSLQGEKEFLTEIELLSRLHHRNLVSLLGFCDEEGEQMLVYEYMENGTLRDNISVKLKEPLDFAMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSRFTAKVADFGLSRLAPVPDMEGISPQHVSTVVKGTPGYLDPEYFLTHQLTDKSDVYSLGVVLLELFTGMQPI 831          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5241_ARATH (Probable receptor-like protein kinase At5g24010 OS=Arabidopsis thaliana GN=At5g24010 PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.580e-44
Identity = 94/220 (42.73%), Postives = 133/220 (60.45%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTH----VVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            R  + +L   T  F    ++G GGFG V+RG+L K   ++AVK+ S  SRQG+ EF++EI  + ++RHR+LV L+GYC  + E++LVY+YM  G L  +LY      L+W+QR  V  G A GL YLH    Q +IHRD+K++N+LLD     ++ DFGL+R    G     TH    V G+ GYL PE+ R  + T  +DV+SFG  L EV C R  ++
Sbjct:  476 RISFAELQSGTNNFDRSLVIGVGGFGMVFRGSL-KDNTKVAVKRGSPGSRQGLPEFLSEITILSKIRHRHLVSLVGYCEEQSEMILVYEYMDKGPLKSHLYGSTNPPLSWKQRLEVCIGAARGLHYLHTGSSQGIIHRDIKSTNILLDNNYVAKVADFGLSR---SGPCIDETHVSTGVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAVD 691          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y2393_ARATH (Probable receptor-like protein kinase At2g39360 OS=Arabidopsis thaliana GN=At2g39360 PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.580e-44
Identity = 94/212 (44.34%), Postives = 134/212 (63.21%), Query Frame = 3
Query:   33 ATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYN-QPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTH----VVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            AT  F E  ++G GGFG+VY+G L + K E+AVK+ + +SRQG+ EF  E+  + + RHR+LV L+GYC    E+++VY+YM  G+L  +LY+   K  L+WRQR  +  G A GL YLH    + +IHRDVK++N+LLD     ++ DFGL++    G D   TH    V G+ GYL PE+    + T  +DV+SFG  +LEV CGR  I+
Sbjct:  483 ATDDFDESLVIGVGGFGKVYKGVL-RDKTEVAVKRGAPQSRQGLAEFKTEVEMLTQFRHRHLVSLIGYCDENSEMIIVYEYMEKGTLKDHLYDLDDKPRLSWRQRLEICVGAARGLHYLHTGSTRAIIHRDVKSANILLDDNFMAKVADFGLSKT---GPDLDQTHVSTAVKGSFGYLDPEYLTRQQLTEKSDVYSFGVVMLEVVCGRPVID 690          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: FERON_ARATH (Receptor-like protein kinase FERONIA OS=Arabidopsis thaliana GN=FER PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.580e-44
Identity = 91/214 (42.52%), Postives = 132/214 (61.68%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLAR---LYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            F + ++  ATK F E  +LG GGFG+VYRG +     ++A+K+ +  S QG+ EF  EI  + +LRHR+LV L+GYC    E++LVYDYM +G++ ++LY     +L W+QR  +  G A GL YLH   +  +IHRDVK +N+LLD +   ++ DFGL++     DH     +T V G+ GYL PE+ R  + T  +DV+SFG  L E  C R
Sbjct:  524 FSFAEIKAATKNFDESRVLGVGGFGKVYRGEIDGGTTKVAIKRGNPMSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCEENCEMILVYDYMAHGTMREHLYKTQNPSLPWKQRLEICIGAARGLHYLHTGAKHTIIHRDVKTTNILLDEKWVAKVSDFGLSKTGPTLDH--THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCAR 735          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CX32_ARATH (Probable serine/threonine-protein kinase Cx32, chloroplastic OS=Arabidopsis thaliana GN=At4g35600 PE=1 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 3.369e-44
Identity = 100/222 (45.05%), Postives = 138/222 (62.16%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRG-----TLPKSKIE----IAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLY--NQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ-TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACG 638
            + + DL  ATK F+   +LG GGFG+VYRG     TL  S++     +A+K+++ ES QG  E+ +E+  +G L HRNLV+LLGYCR   ELLLVY++MP GSL+ +L+  N P     W  R  ++ G A GL +LH   ++ VI+RD KASN+LLD   + +L DFGLA+L         TT ++GT GY APE+  TG     +DVF+FG  LLE+  G
Sbjct:   74 YNFLDLKTATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIVAIKRLNSESVQGFAEWRSEVNFLGMLSHRNLVKLLGYCREDKELLLVYEFMPKGSLESHLFRRNDP---FPWDLRIKIVIGAARGLAFLH-SLQREVIYRDFKASNILLDSNYDAKLSDFGLAKLGPADEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTG 291          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: APK1B_ARATH (Protein kinase APK1B, chloroplastic OS=Arabidopsis thaliana GN=APK1B PE=2 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 3.369e-44
Identity = 100/228 (43.86%), Postives = 140/228 (61.40%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRG-----TLPKSK----IEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV--TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ-TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIER 656
            F + +L  AT+ FR   +LG GGFG V++G     TL  SK    + IAVKK++ +  QG +E++AE+  +G+  H NLV+L+GYC      LLVY++MP GSL+ +L+ +      L+W  R  V  G A GL +LH   E  VI+RD K SN+LLD E N +L DFGLA+    G     +T ++GT GY APE+  TG  TT +DV+S+G  LLEV  GRR +++
Sbjct:   57 FTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWTLRLKVALGAAKGLAFLHNA-ETSVIYRDFKTSNILLDSEYNAKLSDFGLAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDK 283          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: SERK2_ARATH (Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.400e-44
Identity = 96/219 (43.84%), Postives = 134/219 (61.19%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMK-EFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP--KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            RF  ++L +AT  F  K +LG GGFG+VY+G L    + +AVK++  E   G + +F  E+  I    HRNL++L G+C    E LLVY YM NGS+   L  +P  ++ L W  R  +  G A GL YLH+  +  +IHRDVKA+N+LLD E    +GDFGLARL D+     TT V GT+G++APE+  TGK++   DVF +G  LLE+  G+R  +
Sbjct:  292 RFSLRELQVATDSFSNKNILGRGGFGKVYKGRLADGTL-VAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFD 509          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RKF1_ARATH1.158e-4442.45Probable LRR receptor-like serine/threonine-protei... [more]
PSYR1_ARATH1.158e-4441.70Tyrosine-sulfated glycopeptide receptor 1 OS=Arabi... [more]
BAK1_ARATH1.512e-4443.38BRASSINOSTEROID INSENSITIVE 1-associated receptor ... [more]
Y1684_ARATH1.975e-4444.09Probable LRR receptor-like serine/threonine-protei... [more]
Y5241_ARATH2.580e-4442.73Probable receptor-like protein kinase At5g24010 OS... [more]
Y2393_ARATH2.580e-4444.34Probable receptor-like protein kinase At2g39360 OS... [more]
FERON_ARATH2.580e-4442.52Receptor-like protein kinase FERONIA OS=Arabidopsi... [more]
CX32_ARATH3.369e-4445.05Probable serine/threonine-protein kinase Cx32, chl... [more]
APK1B_ARATH3.369e-4443.86Protein kinase APK1B, chloroplastic OS=Arabidopsis... [more]
SERK2_ARATH4.400e-4443.84Somatic embryogenesis receptor kinase 2 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top