FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: SERK1_ARATH (Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2)

HSP 1 Score: 177.563 bits (449), Expect = 5.747e-44
Identity = 95/219 (43.38%), Postives = 135/219 (61.64%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMK-EFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP--KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            RF  ++L +A+ GF  K +LG GGFG+VY+G L    + +AVK++  E   G + +F  E+  I    HRNL++L G+C    E LLVY YM NGS+   L  +P  +  L+W  R  +  G A GL YLH+  +  +IHRDVKA+N+LLD E    +GDFGLA+L D+     TT V GT+G++APE+  TGK++   DVF +G  LLE+  G+R  +
Sbjct:  289 RFSLRELQVASDGFSNKNILGRGGFGKVYKGRLADGTL-VAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQPPLDWPTRKRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFD 506          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK3_ARATH (Cysteine-rich receptor-like protein kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 7.506e-44
Identity = 95/213 (44.60%), Postives = 133/213 (62.44%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            F Y++L  AT  F +K  LG GG G VY+G L   K  +AVK++   ++Q +  F  E+  I ++ H+NLV+LLG      E LLVY+Y+ N SL  YL+ +  V  LNW +R+ +I G A G+ YLHEE    +IHRD+K SN+LL+ +   R+ DFGLARL+       +T + GTLGY+APE+   GK T  ADV+SFG  ++EV  G+R
Sbjct:  311 FSYENLERATDYFSDKNKLGQGGSGSVYKGVLTNGKT-VAVKRLFFNTKQWVDHFFNEVNLISQVDHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQPLNWAKRFKIILGTAEGMAYLHEESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHISTAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGKR 522          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: APK1A_ARATH (Protein kinase APK1A, chloroplastic OS=Arabidopsis thaliana GN=APK1A PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 7.506e-44
Identity = 101/231 (43.72%), Postives = 142/231 (61.47%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTL---------PKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKY-----LYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ-TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIER 656
            F + +L  AT+ FR   +LG GGFG V++G +         P + + IAVKK++ +  QG +E++AE+  +G+  HR+LV+L+GYC      LLVY++MP GSL+ +     LY QP   L+W+ R  V  G A GL +LH   E  VI+RD K SN+LLD E N +L DFGLA+    G     +T V+GT GY APE+  TG  TT +DV+SFG  LLE+  GRR +++
Sbjct:   56 FSFAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGLYFQP---LSWKLRLKVALGAAKGLAFLHSS-ETRVIYRDFKTSNILLDSEYNAKLSDFGLAKDGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDK 282          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: BRL2_ARATH (Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.803e-44
Identity = 90/223 (40.36%), Postives = 140/223 (62.78%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLY----NQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDH-GTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQ 659
            + ++  L  AT GF    ++G GGFG V++ TL K    +A+KK+   S QG +EF+AE+ ++G+++HRNLV LLGYC+   E LLVY++M  GSL++ L+     + +  L W +R  + KG A GL +LH      +IHRD+K+SNVLLD ++  R+ DFG+ARL     T    + + GT GY+ PE+ ++ + T   DV+S G  +LE+  G+RP +++
Sbjct:  825 KLKFSQLIEATNGFSAASMIGHGGFGEVFKATL-KDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKIGEERLLVYEFMQYGSLEEVLHGPRTGEKRRILGWEERKKIAKGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDQDMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSIGVVMLEILSGKRPTDKE 1046          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5389_ARATH (Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.280e-43
Identity = 97/226 (42.92%), Postives = 136/226 (60.18%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT---LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTH----VVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQS 662
            RF   ++  AT  F EK ++G GGFG VY+G +      +AVK++   S QG KEF  E+  + +LRH +LV L+GYC    E++LVY+YMP+G+L  +L+ + K +   L+W++R  +  G A GL YLH   +  +IHRD+K +N+LLD     ++ DFGL+R+    T    TH    V GT GYL PE+ R    T  +DV+SFG  LLEV C  RPI  QS
Sbjct:  512 RFSIYEIKSATNDFEEKLIIGVGGFGSVYKGRIDGGATLVAVKRLEITSNQGAKEFDTELEMLSKLRHVHLVSLIGYCDDDNEMVLVYEYMPHGTLKDHLFRRDKASDPPLSWKRRLEICIGAARGLQYLHTGAKYTIIHRDIKTTNILLDENFVAKVSDFGLSRV--GPTSASQTHVSTVVKGTFGYLDPEYYRRQILTEKSDVYSFGVVLLEVLC-CRPIRMQS 734          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: FEI1_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.672e-43
Identity = 91/212 (42.92%), Postives = 131/212 (61.79%), Query Frame = 3
Query:   18 KDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            KD+    +   E+ ++G GGFG VY+  +   K+  A+K+I   +    + F  E+  +G ++HR LV L GYC      LL+YDY+P GSLD+ L+ + +  L+W  R  +I G A GL YLH +    +IHRD+K+SN+LLDG L  R+ DFGLA+L +      TT V GT GYLAPE+ ++G+AT   DV+SFG  +LEV  G+RP +
Sbjct:  297 KDIIKKLEMLNEEHIIGCGGFGTVYKLAMDDGKV-FALKRILKLNEGFDRFFERELEILGSIKHRYLVNLRGYCNSPTSKLLLYDYLPGGSLDEALHERGE-QLDWDSRVNIIIGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKRPTD 506          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5900_ARATH (Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.184e-43
Identity = 96/226 (42.48%), Postives = 136/226 (60.18%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT---LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTH----VVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQS 662
            RF   ++  AT  F +K ++G GGFG VY+G +      +AVK++   S QG KEF  E+  + +LRH +LV L+GYC    E++LVY+YMP+G+L  +L+ + K +   L+W++R  +  G A GL YLH   +  +IHRD+K +N+LLD     ++ DFGL+R+    T    TH    V GT GYL PE+ R    T  +DV+SFG  LLEV C  RPI  QS
Sbjct:  505 RFSIFEIKSATNDFEDKLIIGVGGFGSVYKGQIDGGATLVAVKRLEITSNQGAKEFETELEMLSKLRHVHLVSLIGYCDEDNEMVLVYEYMPHGTLKDHLFRRDKTSDPPLSWKRRLEICIGAARGLQYLHTGAKYTIIHRDIKTTNILLDENFVTKVSDFGLSRV--GPTSASQTHVSTVVKGTFGYLDPEYYRRQVLTEKSDVYSFGVVLLEVLC-CRPIRMQS 727          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: ANX2_ARATH (Receptor-like protein kinase ANXUR2 OS=Arabidopsis thaliana GN=ANX2 PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.184e-43
Identity = 90/213 (42.25%), Postives = 129/213 (60.56%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVV-GTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            RF   ++   T  F E  ++G GGFG+VY+G +     ++A+KK +  S QG+ EF  EI  + RLRH++LV L+GYC   GE+ L+YDYM  G+L ++LYN  +  L W++R  +  G A GL YLH   +  +IHRDVK +N+LLD     ++ DFGL++   +      T VV G+ GYL PE+ R  + T  +DV+SFG  L EV C R
Sbjct:  508 RFSLSEIKHGTHNFDESNVIGVGGFGKVYKGVIDGGT-KVAIKKSNPNSEQGLNEFETEIELLSRLRHKHLVSLIGYCDEGGEMCLIYDYMSLGTLREHLYNTKRPQLTWKRRLEIAIGAARGLHYLHTGAKYTIIHRDVKTTNILLDENWVAKVSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCAR 719          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: ANX1_ARATH (Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.184e-43
Identity = 90/213 (42.25%), Postives = 131/213 (61.50%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVV-GTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            RF   ++   T+ F +  ++G GGFG+VY+G +  +  ++AVKK +  S QG+ EF  EI  + RLRH++LV L+GYC   GE+ LVYDYM  G+L ++LYN  K  L W++R  +  G A GL YLH   +  +IHRDVK +N+L+D     ++ DFGL++   +      T VV G+ GYL PE+ R  + T  +DV+SFG  L E+ C R
Sbjct:  504 RFSLPEIKHGTQNFDDSNVIGVGGFGKVYKGVIDGTT-KVAVKKSNPNSEQGLNEFETEIELLSRLRHKHLVSLIGYCDEGGEMCLVYDYMAFGTLREHLYNTKKPQLTWKRRLEIAIGAARGLHYLHTGAKYTIIHRDVKTTNILVDENWVAKVSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR 715          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5597_ARATH (Probable receptor-like protein kinase At5g59700 OS=Arabidopsis thaliana GN=At5g59700 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.852e-43
Identity = 92/211 (43.60%), Postives = 132/211 (62.56%), Query Frame = 3
Query:   33 ATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTH----VVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            AT  F E   +G GGFG+VY+G L     ++AVK+ + +S+QG+ EF  EI  + + RHR+LV L+GYC    E++LVY+YM NG+L  +LY    ++L+W+QR  +  G A GL YLH    + VIHRDVK++N+LLD  L  ++ DFGL++    G +   TH    V G+ GYL PE+ R  + T  +DV+SFG  + EV C R  I+
Sbjct:  478 ATNSFDENRAIGVGGFGKVYKGELHDGT-KVAVKRANPKSQQGLAEFRTEIEMLSQFRHRHLVSLIGYCDENNEMILVYEYMENGTLKSHLYGSGLLSLSWKQRLEICIGSARGLHYLHTGDAKPVIHRDVKSANILLDENLMAKVADFGLSKT---GPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVMFEVLCARPVID 684          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SERK1_ARATH5.747e-4443.38Somatic embryogenesis receptor kinase 1 OS=Arabido... [more]
CRK3_ARATH7.506e-4444.60Cysteine-rich receptor-like protein kinase 3 OS=Ar... [more]
APK1A_ARATH7.506e-4443.72Protein kinase APK1A, chloroplastic OS=Arabidopsis... [more]
BRL2_ARATH9.803e-4440.36Serine/threonine-protein kinase BRI1-like 2 OS=Ara... [more]
Y5389_ARATH1.280e-4342.92Probable receptor-like protein kinase At5g38990 OS... [more]
FEI1_ARATH1.672e-4342.92LRR receptor-like serine/threonine-protein kinase ... [more]
Y5900_ARATH2.184e-4342.48Putative receptor-like protein kinase At5g39000 OS... [more]
ANX2_ARATH2.184e-4342.25Receptor-like protein kinase ANXUR2 OS=Arabidopsis... [more]
ANX1_ARATH2.184e-4342.25Receptor-like protein kinase ANXUR1 OS=Arabidopsis... [more]
Y5597_ARATH2.852e-4343.60Probable receptor-like protein kinase At5g59700 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top