FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y1357_ARATH (Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.852e-43
Identity = 94/218 (43.12%), Postives = 132/218 (60.55%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARL---YDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPI 650
            +F   ++  ATK F +   +G GGFG+VYRG L    + IA+K+ +  S+QG+ EF  EIV + RLRHR+LV L+G+C    E++LVY+YM NG+L  +L+      L+W+QR     G A GL YLH   E+ +IHRDVK +N+LLD     ++ DFGL++     DH     +T V G+ GYL PE+ R  + T  +DV+SFG  L E  C R  I
Sbjct:  507 KFTLAEIRAATKNFDDGLAIGVGGFGKVYRGELEDGTL-IAIKRATPHSQQGLAEFETEIVMLSRLRHRHLVSLIGFCDEHNEMILVYEYMANGTLRSHLFGSNLPPLSWKQRLEACIGSARGLHYLHTGSERGIIHRDVKTTNILLDENFVAKMSDFGLSKAGPSMDH--THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEAVCARAVI 721          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y2317_ARATH (Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.725e-43
Identity = 88/229 (38.43%), Postives = 137/229 (59.83%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKI-------SHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGEL--LLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQSQ 665
            RF  KD+  ATKGF +  ++G G  G VY+  +P  K  IAVKK+       ++ S      F AEI+++G++RHRN+V+L  +C  +G    LL+Y+YM  GSL + L+     +++W  R+ +  G A GL YLH + +  +IHRD+K++N+L+D      +GDFGLA++ D       + V G+ GY+APE++ T K T   D++SFG  LLE+  G+ P++   Q
Sbjct:  806 RFTVKDILEATKGFHDSYIVGRGACGTVYKAVMPSGKT-IAVKKLESNREGNNNNSNNTDNSFRAEILTLGKIRHRNIVRLYSFCYHQGSNSNLLLYEYMSRGSLGELLHGGKSHSMDWPTRFAIALGAAEGLAYLHHDCKPRIIHRDIKSNNILIDENFEAHVGDFGLAKVIDMPLSKSVSAVAGSYGYIAPEYAYTMKVTEKCDIYSFGVVLLELLTGKAPVQPLEQ 1033          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5707_ARATH (Probable receptor-like protein kinase At5g47070 OS=Arabidopsis thaliana GN=At5g47070 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.354e-43
Identity = 100/230 (43.48%), Postives = 141/230 (61.30%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKS------KIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGEL----LLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHV----VGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIER 656
            F Y++L  AT  F  K ++G GGFG VY+G +  +       + +A+KK++ +  QG K+++AE+  +G + H N+V+L+GYC   GE     LLVY+YM N SL+ +L+ +   TL W++R  ++ G A GL YLH+     VI+RD K+SNVLLD +   +L DFGLAR    G D   THV    VGT GY APE+ +TG     +DV+SFG  L E+  GRR IER
Sbjct:   74 FSYEELSKATYVFSRKLVIGEGGFGIVYKGKILSNGDSSDPPLVVAIKKLNRQGLQGHKQWLAEVQFLGVVNHPNVVKLIGYCSEDGETGIERLLVYEYMSNRSLEDHLFPRRSHTLPWKKRLEIMLGAAEGLTYLHD---LKVIYRDFKSSNVLLDDQFCPKLSDFGLAR---EGPDGDNTHVTTARVGTHGYAAPEYVQTGHLRLKSDVYSFGVVLYEIITGRRTIER 297          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5129_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g10290 OS=Arabidopsis thaliana GN=At5g10290 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.354e-43
Identity = 97/219 (44.29%), Postives = 134/219 (61.19%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISH-ESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYL--YNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            RF +++L +AT  F EK +LG GGFG+VY+G LP +  ++AVK+++  ES  G   F  E+  I    HRNL++L+G+C  + E LLVY +M N SL   L         L+W  R  +  G A G  YLHE     +IHRDVKA+NVLLD +    +GDFGLA+L D      TT V GT+G++APE+  TGK++   DVF +G  LLE+  G+R I+
Sbjct:  277 RFAWRELQLATDNFSEKNVLGQGGFGKVYKGVLPDNT-KVAVKRLTDFESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTQTERLLVYPFMQNLSLAHRLREIKAGDPVLDWETRKRIALGAARGFEYLHEHCNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRTNVTTQVRGTMGHIAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAID 494          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: BRL3_ARATH (Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.354e-43
Identity = 92/220 (41.82%), Postives = 137/220 (62.27%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK---VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDH-GTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            +  +  L  AT GF    ++GSGGFG VY+  L    + +A+KK+   + QG +EF+AE+ +IG+++HRNLV LLGYC+   E LLVY+YM  GSL+  L+ + K   + L+W  R  +  G A GL +LH      +IHRD+K+SNVLLD +   R+ DFG+ARL     T    + + GT GY+ PE+ ++ + T   DV+S+G  LLE+  G++PI+
Sbjct:  845 KLTFAHLLEATNGFSADSMIGSGGFGDVYKAKLADGSV-VAIKKLIQVTGQGDREFMAEMETIGKIKHRNLVPLLGYCKIGEERLLVYEYMKYGSLETVLHEKTKKGGIFLDWSARKKIAIGAARGLAFLHHSCIPHIIHRDMKSSNVLLDQDFVARVSDFGMARLVSALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPID 1063          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.354e-43
Identity = 92/221 (41.63%), Postives = 137/221 (61.99%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK----VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDH-GTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            +  +  L  AT GF  + ++GSGGFG VY+  L    + +A+KK+   + QG +EF+AE+ +IG+++HRNLV LLGYC+   E LLVY+YM  GSL+  L+ +      + LNW  R  +  G A GL +LH      +IHRD+K+SNVLLD +   R+ DFG+ARL     T    + + GT GY+ PE+ ++ + T   DV+S+G  LLE+  G++PI+
Sbjct:  846 KLTFAHLLEATNGFSAETMVGSGGFGEVYKAQLRDGSV-VAIKKLIRITGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKWGSLETVLHEKSSKKGGIYLNWAARKKIAIGAARGLAFLHHSCIPHIIHRDMKSSNVLLDEDFEARVSDFGMARLVSALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPID 1065          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5613_ARATH (Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 8.299e-43
Identity = 95/223 (42.60%), Postives = 131/223 (58.74%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYN------QPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIERQ 659
            F + +L  AT+ F E  + G GGFG+VY G +     ++A+K+ S  S QG+ EF  EI  + +LRHR+LV L+G+C    E++LVY+YM NG L  +LY        P  TL+W+QR  +  G A GL YLH    Q +IHRDVK +N+LLD  L  ++ DFGL++         +T V G+ GYL PE+ R  + T  +DV+SFG  L EV C R  I  Q
Sbjct:  513 FPFTELQTATQNFDENAVCGVGGFGKVYIGEIDGGT-QVAIKRGSQSSEQGINEFQTEIQMLSKLRHRHLVSLIGFCDENKEMILVYEYMSNGPLRDHLYGSKENDPNPIPTLSWKQRLEICIGSARGLHYLHTGAAQGIIHRDVKTTNILLDENLVAKVSDFGLSKDAPMDEGHVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPVINPQ 734          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: FEI2_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 2 OS=Arabidopsis thaliana GN=FEI2 PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.084e-42
Identity = 89/212 (41.98%), Postives = 130/212 (61.32%), Query Frame = 3
Query:   18 KDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            KD+    +   E+ ++G GGFG VY+ ++    +  A+K+I   +    + F  E+  +G ++HR LV L GYC      LL+YDY+P GSLD+ L+ + +  L+W  R  +I G A GL YLH +    +IHRD+K+SN+LLDG L  R+ DFGLA+L +      TT V GT GYLAPE+ ++G+AT   DV+SFG  +LEV  G+ P +
Sbjct:  295 KDIIKKLESLNEEHIIGCGGFGTVYKLSMDDGNV-FALKRIVKLNEGFDRFFERELEILGSIKHRYLVNLRGYCNSPTSKLLLYDYLPGGSLDEALHKRGE-QLDWDSRVNIIIGAAKGLAYLHHDCSPRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKLPTD 504          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: TMK1_ARATH (Probable receptor protein kinase TMK1 OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.849e-42
Identity = 95/220 (43.18%), Postives = 135/220 (61.36%), Query Frame = 3
Query:   36 TKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHE--SRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLN---WRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPI-ERQSQKRIY 677
            T  F    +LGSGGFG VY+G L     +IAVK++ +   + +G  EF +EI  + ++RHR+LV LLGYC    E LLVY+YMP G+L ++L+   +  L    W+QR  +   VA G+ YLH    Q  IHRD+K SN+LL  ++  ++ DFGL RL   G     T + GT GYLAPE++ TG+ TT  DV+SFG  L+E+  GR+ + E Q ++ I+
Sbjct:  585 TNNFSSDNILGSGGFGVVYKGELHDGT-KIAVKRMENGVIAGKGFAEFKSEIAVLTKVRHRHLVTLLGYCLDGNEKLLVYEYMPQGTLSRHLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELITGRKSLDESQPEESIH 803          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: RPK2_ARATH (LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.849e-42
Identity = 87/207 (42.03%), Postives = 133/207 (64.25%), Query Frame = 3
Query:   33 ATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            AT  F    L+G+GGFG  Y+  + +  + +A+K++S    QG+++F AEI ++GRLRH NLV L+GY   + E+ LVY+Y+P G+L+K++  Q + T +WR  + +   +A  L YLH++    V+HRDVK SN+LLD + N  L DFGLARL        TT V GT GY+APE++ T + +  ADV+S+G  LLE+   ++ ++
Sbjct:  870 ATGNFNASNLIGNGGFGATYKAEISQDVV-VAIKRLSIGRFQGVQQFHAEIKTLGRLRHPNLVTLIGYHASETEMFLVYNYLPGGNLEKFI--QERSTRDWRVLHKIALDIARALAYLHDQCVPRVLHRDVKPSNILLDDDCNAYLSDFGLARLLGTSETHATTGVAGTFGYVAPEYAMTCRVSDKADVYSYGVVLLELLSDKKALD 1073          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
Y1357_ARATH2.852e-4343.12Probable receptor-like protein kinase At1g30570 OS... [more]
Y2317_ARATH3.725e-4338.43Probable leucine-rich repeat receptor-like protein... [more]
Y5707_ARATH6.354e-4343.48Probable receptor-like protein kinase At5g47070 OS... [more]
Y5129_ARATH6.354e-4344.29Probable LRR receptor-like serine/threonine-protei... [more]
BRL3_ARATH6.354e-4341.82Receptor-like protein kinase BRI1-like 3 OS=Arabid... [more]
BRL1_ARATH6.354e-4341.63Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]
Y5613_ARATH8.299e-4342.60Probable receptor-like protein kinase At5g61350 OS... [more]
FEI2_ARATH1.084e-4241.98LRR receptor-like serine/threonine-protein kinase ... [more]
TMK1_ARATH1.849e-4243.18Probable receptor protein kinase TMK1 OS=Arabidops... [more]
RPK2_ARATH1.849e-4242.03LRR receptor-like serine/threonine-protein kinase ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top