FC931429

Overview
NameFC931429
Unique NameFC931429
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length713
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15323 contig Ccv1_Contig15323:1..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR12_ORYSJ (Pleiotropic drug resistance protein 12 OS=Oryza sativa subsp. japonica GN=PDR12 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.361e-48
Identity = 93/236 (39.41%), Postives = 135/236 (57.20%), Query Frame = 2
Query:    5 LGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMD---DKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            +G +      L   +G M+TAV+F+G+  C++VQPIVS+ERTVFYRE+AAGMY+ +P+A+AQV++EIPY+ VQ+  Y  IVYAM+ F+WTAAKFFW+                M VA++PNH +AAI +  FY L+N+FSGF             YYW  P+AWT+YGL+ +Q+GD++        + +T+  ++  +F +                          IK  NFQ R
Sbjct: 1265 IGTKMGNANSLRMVIGAMYTAVMFIGINNCATVQPIVSIERTVFYRERAAGMYSAMPYAIAQVVMEIPYVFVQTAYYTLIVYAMMSFQWTAAKFFWFFFVSYFSFLYFTYYGMMTVAISPNHEVAAIFAAAFYSLFNLFSGFFIPRPRIPKWWIWYYWLCPLAWTVYGLIVTQYGDLEQIISVPGQSNQTISYYVTHHFGYHRKFMPVVAPVLVLFAVFFAFMYAICIKKLNFQHR 1500          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB38G_ARATH (ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.137e-45
Identity = 92/233 (39.48%), Postives = 135/233 (57.94%), Query Frame = 2
Query:    5 LGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            LG R    QD+FN++G M T V FL  Q  ++V+P+V  ERTVFYRE  AGMY+ +P+A +QV+IEIPY + Q+ +YG IVY MIG+EWTA+KFF  I               M ++++PN  IA+I++ +    WNVFSGF             + +  P  W LYGL  +Q+GD+ + ++DTGETV +F+K+Y+ ++++                       +K+ NFQKR
Sbjct: 1187 LGKRKGTRQDIFNSVGAMSTVVGFLSSQSAATVRPVVIAERTVFYREAGAGMYSALPYAFSQVIIEIPYTMAQACIYGVIVYGMIGYEWTASKFFLNIFFTFISILYSIYTGIMVISVSPNQEIASILNGVISTSWNVFSGFTIPRPRMHVWLRWFTYVCPGWWGLYGLTIAQYGDV-ETRLDTGETVVEFMKNYYGYEYNFLWVVSLTLIAFSMFFVFIYAFSVKILNFQKR 1418          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR3_TOBAC (Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 6.121e-41
Identity = 88/236 (37.29%), Postives = 126/236 (53.39%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDK--KMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            D G +    Q +F+  G MFTAV+F G+   SSV P V+ ER+V YRE+ AGMYA   +ALAQV IEIPY+L Q++ +  I Y MIG+ W+A K FWY                M V++TP+  +AAI+ + FY ++N+F+GF+            +Y+  P +WTL G++ SQ+GD++ +       +TV  FL DYF F H+                       I   NFQ+R
Sbjct: 1212 DKGKKLDNQQSVFSVFGAMFTAVIFCGINNSSSVLPYVTTERSVLYRERFAGMYASWAYALAQVAIEIPYLLAQALAFTVITYPMIGYYWSAYKVFWYFYSMFCTLLYFTYLGMMLVSMTPSFPVAAILQSSFYTMFNLFAGFLMPKAQIPKWWIWFYYLTPTSWTLNGMLTSQYGDIEKEITVFQEKKTVAAFLGDYFGFHHNQLPIVAFVLIAYPLVFASLFAFFIGKLNFQRR 1447          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR13_ORYSJ (Pleiotropic drug resistance protein 13 OS=Oryza sativa subsp. japonica GN=PDR13 PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 6.121e-41
Identity = 89/238 (37.39%), Postives = 130/238 (54.62%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQV---MIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTG--ETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQK 700
            ++G + +  +D+   MG ++ A LFLGV   SSVQP+VSVERTV+YRE+AA MY+  P+A AQV   ++EIPYI VQ++++G I Y M+ +E    K   Y+               +AV LTP  H+A++VS+ FY LWN+ SGF+            +Y+  P+AWTL G++ SQ GD+D + +  G   TV +FL+    F+                         IKM NFQ+
Sbjct: 1203 NVGMKRESTEDILLLMGALYAACLFLGVNNASSVQPVVSVERTVYYRERAANMYSSFPYAAAQVYHGLVEIPYIAVQTLIFGLITYFMVNYERNIRKLVLYLIYMFLTFTYFTFYGMVAVGLTPTQHMASVVSSAFYSLWNLLSGFLIPQSRIPGWWIWFYYICPVAWTLRGVITSQLGDVDTRIVGPGFDGTVHEFLQQNLGFEQGMTGATVAVLVAFSVFFFSIYAISIKMINFQR 1440          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR5_ORYSJ (Pleiotropic drug resistance protein 5 OS=Oryza sativa subsp. japonica GN=PDR5 PE=2 SV=2)

HSP 1 Score: 166.392 bits (420), Expect = 1.364e-40
Identity = 88/228 (38.60%), Postives = 121/228 (53.07%), Query Frame = 2
Query:   32 DLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGET----VKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            DL N +G  + AV FLG     ++ P+VSVERTVFYREKAAGMY+ + +A AQ  +E  Y  VQ V+Y  ++Y+MIG+EW A KFF+++               M VA T +  +AA++ +     WN F+GF+            +YWANP++WT+YG++ASQF D D      G++    VK FL+    FKHD                       IK  NFQKR
Sbjct: 1227 DLNNLLGATYAAVFFLGAANLLTLLPVVSVERTVFYREKAAGMYSPLSYAFAQGFVEFCYSAVQGVLYTILIYSMIGYEWKADKFFYFLFFMIAAFAYFTLFSMMLVACTASEMLAAVLVSFVLSSWNNFAGFIIPRPLIPVWWRWFYWANPVSWTIYGVIASQFADSDRVVTVPGQSTTMVVKDFLEKNMGFKHDFLGYVVLAHFGYVIIFFFLFGYGIKCLNFQKR 1454          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB42G_ARATH (ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.387e-39
Identity = 86/227 (37.89%), Postives = 120/227 (52.86%), Query Frame = 2
Query:   29 QDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGE--TVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            QDLFN  G MFT VLF G+  CS+V   V+ ER VFYRE+ + MY    ++LAQV++EIPY L QS+VY  IVY M+G+ W+  K FW                 + V +TPN HIA  + + FY + N+F+G+V             Y+ +P +W L GL+ SQ+GDM+ + +  GE   V  FL+DYF +++D                       I   NFQK+
Sbjct: 1166 QDLFNVFGSMFTVVLFSGINNCSTVLFSVATERNVFYRERFSRMYNSWAYSLAQVLVEIPYSLFQSIVYVIIVYPMVGYHWSVFKVFWSFYSIFCTLLIFNYFGMLLVVVTPNVHIAFTLRSSFYAIVNLFAGYVMPKPNIPRWWIWMYYLSPTSWVLNGLLTSQYGDMEKEILAFGEKKKVSDFLEDYFGYRYDSLALVAVVLIAFPILLASLFAFFIGKLNFQKK 1392          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB43G_ARATH (ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.276e-38
Identity = 85/227 (37.44%), Postives = 120/227 (52.86%), Query Frame = 2
Query:   29 QDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGE--TVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            QDLFN  G MFT VLF G+  CS+V   V+ ER VFYRE+ + MY    ++LAQV++EIPY L QS++Y  IVY M+G+ W+  K FW                 + V +TPN HIA  + + FY + N+F+G+V             Y+ +P +W L GL+ SQ+GDM+ + +  GE   V  FL+DYF +++D                       I   NFQK+
Sbjct: 1164 QDLFNVFGSMFTVVLFSGINNCSTVIFCVATERNVFYRERFSRMYNPWAYSLAQVLVEIPYSLFQSIIYVIIVYPMVGYHWSVYKVFWSFYSIFCSLLIFNYFGMLLVVVTPNVHIAFTLRSSFYAIVNLFAGYVMPKPNIPRWWIWMYYLSPTSWVLNGLLTSQYGDMEKEILAFGEKKKVSAFLEDYFGYRYDSLALVAVVLIAFPILLASLFAFFIGKLNFQKK 1390          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB41G_ARATH (ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.661e-36
Identity = 78/227 (34.36%), Postives = 122/227 (53.74%), Query Frame = 2
Query:   29 QDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGE--TVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            QDLF+  G M+T V+F G+  C++V   ++ ER VFYRE+ A MY+   ++ +QV++E+PY L+QS++   IVY MIG+  +  K FW +               + VALTPN H+A  + + F+ + N+F+GFV             Y+ +P +W L GL++SQ+GD++ +    GE  +V  FL+DYF +KHD                       +   NFQK+
Sbjct: 1171 QDLFSIFGSMYTIVIFSGINNCATVMNFIATERNVFYRERFARMYSSWAYSFSQVLVEVPYSLLQSLLCTIIVYPMIGYHMSVYKMFWSLYSIFCSLLIFNYCGMLMVALTPNIHMALTLRSTFFSMVNLFAGFVMPKQKIPKWWIWMYYLSPTSWVLEGLLSSQYGDVEKEITVFGEKKSVSAFLEDYFGYKHDSLAVVAFVLIAFPIIVASLFAFFMSKLNFQKK 1397          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB33G_ARATH (ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.929e-36
Identity = 80/234 (34.19%), Postives = 118/234 (50.43%), Query Frame = 2
Query:    8 GGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGE--TVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            G +    Q+LF  +G ++  VLF+G+  C+S       ER V YRE+ AGMY+   +ALAQV+ EIPYI +QS  +  ++Y MIGF  + +K FW +                 +++TPN  +AAI+ +LF+  +N+F+GF+            +Y+  P +WTL    +SQ+GD+  K    GE  TV  FL+DYF F HD                       +   NFQKR
Sbjct: 1180 GKKIDTQQNLFTVLGAIYGLVLFVGINNCTSALQYFETERNVMYRERFAGMYSAFAYALAQVVTEIPYIFIQSAEFVIVIYPMIGFYASFSKVFWSLYAMFCNLLCFNYLAMFLISITPNFMVAAILQSLFFTTFNIFAGFLIPKPQIPKWWVWFYYITPTSWTLNLFFSSQYGDIHQKINAFGETKTVASFLEDYFGFHHDRLMITAIILIAFPIALATMYAFFVAKLNFQKR 1413          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB37G_ARATH (ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.943e-35
Identity = 81/234 (34.62%), Postives = 116/234 (49.57%), Query Frame = 2
Query:    8 GGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGE--TVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            G      Q +F   G ++  VLFLG+  C+S       ER V YRE+ AGMY+   +AL QV+ EIPYI +Q+  +  + Y MIGF  +A K FW +                 V++TPN  +AAI+ +LFY  +N+FSGF+             Y+  P +WTL G ++SQ+GD+ ++    G+  TV +FLKDYF F HD                       +   NFQ+R
Sbjct: 1217 GQNLDTQQSMFTVFGAIYGLVLFLGINNCASALQYFETERNVMYRERFAGMYSATAYALGQVVTEIPYIFIQAAEFVIVTYPMIGFYPSAYKVFWSLYSMFCSLLTFNYLAMFLVSITPNFMVAAILQSLFYVGFNLFSGFLIPQTQVPGWWIWLYYLTPTSWTLNGFISSQYGDIHEEINVFGQSTTVARFLKDYFGFHHDLLAVTAVVQIAFPIALASMFAFFVGKLNFQRR 1450          
The following BLAST results are available for this feature:
BLAST of FC931429 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
PDR12_ORYSJ1.361e-4839.41Pleiotropic drug resistance protein 12 OS=Oryza sa... [more]
AB38G_ARATH3.137e-4539.48ABC transporter G family member 38 OS=Arabidopsis ... [more]
PDR3_TOBAC6.121e-4137.29Pleiotropic drug resistance protein 3 OS=Nicotiana... [more]
PDR13_ORYSJ6.121e-4137.39Pleiotropic drug resistance protein 13 OS=Oryza sa... [more]
PDR5_ORYSJ1.364e-4038.60Pleiotropic drug resistance protein 5 OS=Oryza sat... [more]
AB42G_ARATH4.387e-3937.89ABC transporter G family member 42 OS=Arabidopsis ... [more]
AB43G_ARATH1.276e-3837.44ABC transporter G family member 43 OS=Arabidopsis ... [more]
AB41G_ARATH2.661e-3634.36ABC transporter G family member 41 OS=Arabidopsis ... [more]
AB33G_ARATH5.929e-3634.19ABC transporter G family member 33 OS=Arabidopsis ... [more]
AB37G_ARATH2.943e-3534.62ABC transporter G family member 37 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105A06EF PostHarvP1 Citrus clementina cDNA clone C34105A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931429 ID=FC931429|Name=FC931429|organism=Citrus clementina|type=EST|length=713bp
GGACCTGGGTGGTAGAACGAAAAGGAACCAAGATCTTTTCAATGCAATGG
GTCCCATGTTTACTGCAGTTCTCTTCCTTGGTGTTCAATATTGTTCGTCA
GTGCAGCCAATAGTATCAGTTGAAAGGACAGTCTTTTACAGGGAAAAAGC
TGCCGGCATGTATGCAGGCATACCATGGGCATTAGCACAAGTTATGATTG
AGATTCCTTATATATTAGTTCAGTCAGTAGTGTATGGTGCTATAGTCTAT
GCTATGATTGGATTTGAATGGACAGCCGCCAAGTTTTTTTGGTATATATT
CTTCATGTACTTCACATTATTGTTCTTCACCTTCTATGGCATGATGGCTG
TGGCTTTGACACCAAACCACCACATCGCTGCCATTGTTTCAACTTTATTT
TATGGATTGTGGAACGTCTTTTCTGGGTTTGTTATCCCAAGACCTAGGAT
TCCAATATGGTGGAGATGGTACTATTGGGCCAACCCCATAGCTTGGACCT
TGTATGGACTGGTTGCTTCGCAGTTCGGAGATATGGACGACAAGAAAATG
GATACTGGTGAAACGGTGAAACAGTTTCTTAAGGACTATTTTGATTTCAA
ACATGATTTTCTGGGAGTAGTTGCAGCTGTTCTCGTTGTCTTTGCAGTGT
TATTTGGATTTCTCTTCGCCCTAGGAATTAAGATGTTTAACTTCCAGAAG
CGGTAGTAATTCT
back to top